8tro

Rod from high-resolution phycobilisome quenched by OCP (local refinement)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-phycocyanin alpha subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	C-phycocyanin beta subunit × 18 （Q54714） Phycobilisome rod-core linker polypeptide CpcG × 1 （P73093） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 1 × 1 （P73203） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 2 × 1 （P73204） Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod × 1 （P73202） PHYCOCYANOBILIN × 54 water × 40	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHCA_SYNY3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–162； UniProt 1–162 Author chain 2； PDBConstruct 1–162； UniProt 1–162 Author chain 4； PDBConstruct 1–162； UniProt 1–162 Author chain 6； PDBConstruct 1–162； UniProt 1–162 Author chain 8； PDBConstruct 1–162； UniProt 1–162 Author chain A； PDBConstruct 1–162； UniProt 1–162 Author chain C； PDBConstruct 1–162； UniProt 1–162 Author chain E； PDBConstruct 1–162； UniProt 1–162 Author chain G； PDBConstruct 1–162； UniProt 1–162 Author chain I； PDBConstruct 1–162； UniProt 1–162 Author chain K； PDBConstruct 1–162； UniProt 1–162 Author chain M； PDBConstruct 1–162； UniProt 1–162 Author chain O； PDBConstruct 1–162； UniProt 1–162 Author chain Q； PDBConstruct 1–162； UniProt 1–162 Author chain S； PDBConstruct 1–162； UniProt 1–162 Author chain U； PDBConstruct 1–162； UniProt 1–162 Author chain W； PDBConstruct 1–162； UniProt 1–162 Author chain Y； PDBConstruct 1–162； UniProt 1–162

C-phycocyanin beta subunit

OrganismNot specified

UniProt Q54714

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	C-phycocyanin alpha subunit × 18 （Q54715） Phycobilisome rod-core linker polypeptide CpcG × 1 （P73093） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 1 × 1 （P73203） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 2 × 1 （P73204） Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod × 1 （P73202） PHYCOCYANOBILIN × 54 water × 40	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHCB_SYNY3
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–172； UniProt 1–172 Author chain 3； PDBConstruct 1–172； UniProt 1–172 Author chain 5； PDBConstruct 1–172； UniProt 1–172 Author chain 7； PDBConstruct 1–172； UniProt 1–172 Author chain 9； PDBConstruct 1–172； UniProt 1–172 Author chain B； PDBConstruct 1–172； UniProt 1–172 Author chain D； PDBConstruct 1–172； UniProt 1–172 Author chain F； PDBConstruct 1–172； UniProt 1–172 Author chain H； PDBConstruct 1–172； UniProt 1–172 Author chain J； PDBConstruct 1–172； UniProt 1–172 Author chain L； PDBConstruct 1–172； UniProt 1–172 Author chain N； PDBConstruct 1–172； UniProt 1–172 Author chain P； PDBConstruct 1–172； UniProt 1–172 Author chain R； PDBConstruct 1–172； UniProt 1–172 Author chain T； PDBConstruct 1–172； UniProt 1–172 Author chain V； PDBConstruct 1–172； UniProt 1–172 Author chain X； PDBConstruct 1–172； UniProt 1–172 Author chain Z； PDBConstruct 1–172； UniProt 1–172

Phycobilisome rod-core linker polypeptide CpcG

OrganismNot specified

UniProt P73093

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	C-phycocyanin alpha subunit × 18 （Q54715） C-phycocyanin beta subunit × 18 （Q54714） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 1 × 1 （P73203） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 2 × 1 （P73204） Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod × 1 （P73202） PHYCOCYANOBILIN × 54 water × 40	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYG_SYNY3
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain a； PDBConstruct 1–249； UniProt 1–249

Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 1

OrganismNot specified

UniProt P73203

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	C-phycocyanin alpha subunit × 18 （Q54715） C-phycocyanin beta subunit × 18 （Q54714） Phycobilisome rod-core linker polypeptide CpcG × 1 （P73093） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 2 × 1 （P73204） Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod × 1 （P73202） PHYCOCYANOBILIN × 54 water × 40	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYR1_SYNY3
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain b； PDBConstruct 1–291； UniProt 1–291

Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 2

OrganismNot specified

UniProt P73204

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	C-phycocyanin alpha subunit × 18 （Q54715） C-phycocyanin beta subunit × 18 （Q54714） Phycobilisome rod-core linker polypeptide CpcG × 1 （P73093） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 1 × 1 （P73203） Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod × 1 （P73202） PHYCOCYANOBILIN × 54 water × 40	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYR2_SYNY3
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain c； PDBConstruct 1–273； UniProt 1–273

Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod

OrganismNot specified

UniProt P73202

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	C-phycocyanin alpha subunit × 18 （Q54715） C-phycocyanin beta subunit × 18 （Q54714） Phycobilisome rod-core linker polypeptide CpcG × 1 （P73093） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 1 × 1 （P73203） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 2 × 1 （P73204） PHYCOCYANOBILIN × 54 water × 40	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYS1_SYNY3
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain d； PDBConstruct 1–83； UniProt 1–83

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8tro
Deposition date deposition_date	2023-08-09
Last revision last_revision	2024-04-17
Structure title title	Rod from high-resolution phycobilisome quenched by OCP (local refinement)
Keywords keywords	Complex, light harvesting, pigment, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8tro__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8tro__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8tro__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	60.40 Å
Rg (electron density)	60.17 Å
Total Rg	60.25 Å
Atom count	107046
Residues	6817
Excluded volume	957280 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8tro__assembly_1__model_1`	40-meric （40）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	C-phycocyanin alpha subunit
Molecular weight formula_weight	17602.5 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,2,4,6,8,A,C,E,G,I,K,M,O,Q,S,U,W,Y
Atom count atom_count	110442

MKTPLTEAVSTADSQGRFLSSTELQIAFGRLRQANAGLQAAKALTDNAQSLVNGAAQAVYNKFPYTTQTQGNNFAADQRGKDKCARDIGYYLRIVTYCLVAGGTGPLDEYLIAGIDEINRTFDLSPSWYVEALKYIKANHGLSGDARDEANSYLDYAINALS

Entity 2 Entity 2 polymer

Description description	C-phycocyanin beta subunit
Molecular weight formula_weight	18156.5 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,3,5,7,9,B,D,F,H,J,L,N,P,R,T,V,X,Z

MFDVFTRVVSQADARGEYLSGSQLDALSATVAEGNKRIDSVNRITGNASAIVSNAARALFAEQPQLIQPGGNAYTSRRMAACLRDMEIILRYVTYATFTGDASVLEDRCLNGLRETYVALGVPGASVAAGVQKMKEAALDIVNDPNGITRGDCSAIVAEIAGYFDRAAAAVA

Entity 3 Entity 3 polymer

Description description	Phycobilisome rod-core linker polypeptide CpcG
Molecular weight formula_weight	28938.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MALPLLNYAPKSQNVRVEGYEIGSEEKPVVFTTENILSSSDMDNLIEAAYRQIFFHAFKWDREKVLESQLRNGQITVRDFVRGLLLSNTFRNSFYEKNSNYRFVEHCVQKILGRDVYSEREKIAWSIVVATKGYQGLIDDLLNSDEYLNNFGYDTVPYQRRRNLPGREAGELPFNIKSPRYDAYHRRQLGFPQIVWQNEVRRFIPQEKKLTAGNPMNFLGMARSINPAANTIPKVSAQNINIEASVPRR

Entity 4 Entity 4 polymer

Description description	Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 1
Molecular weight formula_weight	32558.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MAITTAASRLGVAPYNESRPVELRPDFSLDDAKMVIRAVYRQVLGNDYIMDSERLKGAESLLTNGSISVREFVRTVAKSELYKKKFLYNNFQTRVIELNYKHLLGRAPFSEDEVIFHLDLYENQGFDADIDSYIDSVEYQENFGENIVPYYRFNNQVGDRTVGFTRMFRLYRGYANSDRSQLERSSSRLATELGQNTVSAIVGPSGSNAGWAYRPSRAGNTPAKALGGTVPFGQASKLFRVEITAISAPGYPKVRRSNKAVIVPFEQLNQTLQQINRLGGKVASITPASLS

Entity 5 Entity 5 polymer

Description description	Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 2
Molecular weight formula_weight	30836.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MTSLVSAQRLGIVAVDEAIPLELRSRSTEEEVDAVILAVYRQVLGNDHLMSQERLTSAESLLRGREISVRDFVRAVALSEVYRQKFFHSNPQNRFIELNYKHLLGRAPYDQSEIAFHTDLYHQGGYEAEINSYIDSVEYTENFGDWVVPYFRGFATQRNQKTVGFSRSFQVYRGYATSDRSQGNGSRSRLTRELARNTASPVYAGSTAESLRGTSAGSRNQMYRLQVIQGAAPGRGTRVRRGKAEYLVSYDNLSAKLQQINRQGDTVTMISLA

Entity 6 Entity 6 polymer

Description description	Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod
Molecular weight formula_weight	9333.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MLGQSSLVGYSNTQAANRVFVYEVSGLRQTDANENSAHDIRRSGSVFIKVPYARMNDEMRRISRLGGTIVNIRPYQADSNEQN

Entity 7 Entity 7 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	54

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	3396

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	1.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	435854

Rod from high-resolution phycobilisome quenched by OCP (local refinement)

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-phycocyanin alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

C-phycocyanin beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome rod-core linker polypeptide CpcG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8tro__assembly_1__model_1

8tro__assembly_1__model_1 | I(q)

8tro__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (1)