8txp

Crystal structure of 05.GC.w13.01 Fab in complex with H1 HA from A/California/04/2009(H1N1)

Method: X-RAY DIFFRACTION D_max: 135.2 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hemagglutinin

Influenza A virus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 15 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain A； UniProt 18–344	Fragment：HA1 subdomain (UNP residues 18-344)	Hemagglutinin × 3 （I1ZFF9） GC_w13_A, Fab heavy chain × 3 GC_w13_A, Fab light chain × 3 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 9	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M sodium acetate, pH 6.2, 20% PEG3350	Resolution 2.75 Å R-free 0.292

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8TXP	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
24KR Structural basis of influenza A virus neutralization by broadly active single-domain antibody G2.3 recognizing glycosylated epitope within hemagglutinin stem Deposited 2026-03-08	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–518（518 aa） Chain B 1–518（518 aa） Chain C 1–518（518 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.53 Å
3AL4 Crystal structure of the swine-origin A (H1N1)-2009 influenza A virus hemagglutinin (HA) reveals similar antigenicity to that of the 1918 pandemic virus Deposited 2010-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 18–344（327 aa） Fragment：UNP residues 18-344 Chain B 345–520（176 aa） Fragment：UNP residues 345-520	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG 6000, 5% MPD, 0.1M MES, PH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.87 Å R-free 0.270
3AL4 Crystal structure of the swine-origin A (H1N1)-2009 influenza A virus hemagglutinin (HA) reveals similar antigenicity to that of the 1918 pandemic virus Deposited 2010-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 18–344（327 aa） Fragment：UNP residues 18-344 Chain D 345–520（176 aa） Fragment：UNP residues 345-520	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG 6000, 5% MPD, 0.1M MES, PH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.87 Å R-free 0.270
3AL4 Crystal structure of the swine-origin A (H1N1)-2009 influenza A virus hemagglutinin (HA) reveals similar antigenicity to that of the 1918 pandemic virus Deposited 2010-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 18–344（327 aa） Fragment：UNP residues 18-344 Chain F 345–520（176 aa） Fragment：UNP residues 345-520	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG 6000, 5% MPD, 0.1M MES, PH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.87 Å R-free 0.270
3AL4 Crystal structure of the swine-origin A (H1N1)-2009 influenza A virus hemagglutinin (HA) reveals similar antigenicity to that of the 1918 pandemic virus Deposited 2010-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 18–344（327 aa） Fragment：UNP residues 18-344 Chain H 345–520（176 aa） Fragment：UNP residues 345-520	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG 6000, 5% MPD, 0.1M MES, PH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.87 Å R-free 0.270
3AL4 Crystal structure of the swine-origin A (H1N1)-2009 influenza A virus hemagglutinin (HA) reveals similar antigenicity to that of the 1918 pandemic virus Deposited 2010-07-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain I 18–344（327 aa） Fragment：UNP residues 18-344 Chain J 345–520（176 aa） Fragment：UNP residues 345-520	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG 6000, 5% MPD, 0.1M MES, PH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.87 Å R-free 0.270
3AL4 Crystal structure of the swine-origin A (H1N1)-2009 influenza A virus hemagglutinin (HA) reveals similar antigenicity to that of the 1918 pandemic virus Deposited 2010-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain K 18–344（327 aa） Fragment：UNP residues 18-344 Chain L 345–520（176 aa） Fragment：UNP residues 345-520	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG 6000, 5% MPD, 0.1M MES, PH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.87 Å R-free 0.270
3LZG Crystal structure of a 2009 H1N1 influenza virus hemagglutinin Deposited 2010-03-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain B 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain C 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain D 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain E 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain F 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.8；295.5 K；27% PEG-MME 2000, 0.1M Tris pH 8.8, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 2.60 Å R-free 0.252
3LZG Crystal structure of a 2009 H1N1 influenza virus hemagglutinin Deposited 2010-03-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain H 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain I 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain J 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain K 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain L 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.8；295.5 K；27% PEG-MME 2000, 0.1M Tris pH 8.8, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 2.60 Å R-free 0.252
3UBE Influenza hemagglutinin from the 2009 pandemic in complex with ligand LSTc Deposited 2011-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain B 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain C 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain D 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain E 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain F 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520	Mutation：G205C, R220C Mutation：G205C, R220C Mutation：G205C, R220C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.8；295.5 K；27% PEG-MME 2000, 0.1M Tris pH 8.8, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 2.15 Å R-free 0.252
3UBE Influenza hemagglutinin from the 2009 pandemic in complex with ligand LSTc Deposited 2011-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain H 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain I 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain J 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain K 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain L 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520	Mutation：G205C, R220C Mutation：G205C, R220C Mutation：G205C, R220C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 SIA N-acetyl-alpha-neuraminic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.8；295.5 K；27% PEG-MME 2000, 0.1M Tris pH 8.8, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 2.15 Å R-free 0.252
3UBJ Influenza hemagglutinin from the 2009 pandemic in complex with ligand LSTa Deposited 2011-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain B 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain C 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain D 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain E 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain F 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520	Mutation：G205C, R220C Mutation：G205C, R220C Mutation：G205C, R220C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.8；295.5 K；27% PEG-MME 2000, 0.1M Tris pH 8.8, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 2.25 Å R-free 0.252
3UBJ Influenza hemagglutinin from the 2009 pandemic in complex with ligand LSTa Deposited 2011-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain H 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain I 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain J 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain K 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain L 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520	Mutation：G205C, R220C Mutation：G205C, R220C Mutation：G205C, R220C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.8；295.5 K；27% PEG-MME 2000, 0.1M Tris pH 8.8, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 2.25 Å R-free 0.252
3UBN Influenza hemagglutinin from the 2009 pandemic in complex with ligand 6SLN Deposited 2011-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain B 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain C 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain D 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain E 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain F 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520	Mutation：G205C, R220C Mutation：G205C, R220C Mutation：G205C, R220C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.8；295.5 K；27% PEG-MME 2000, 0.1M Tris pH 8.8, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 2.51 Å R-free 0.253
3UBN Influenza hemagglutinin from the 2009 pandemic in complex with ligand 6SLN Deposited 2011-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain H 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain I 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain J 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain K 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain L 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520	Mutation：G205C, R220C Mutation：G205C, R220C Mutation：G205C, R220C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.8；295.5 K；27% PEG-MME 2000, 0.1M Tris pH 8.8, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 2.51 Å R-free 0.253
3UBQ Influenza hemagglutinin from the 2009 pandemic in complex with ligand 3SLN Deposited 2011-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain B 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain C 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain D 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain E 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain F 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520	Mutation：G205C, R220C Mutation：G205C, R220C Mutation：G205C, R220C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.8；295.5 K；27% PEG-MME 2000, 0.1M Tris pH 8.8, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 2.00 Å R-free 0.249
3UBQ Influenza hemagglutinin from the 2009 pandemic in complex with ligand 3SLN Deposited 2011-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain H 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain I 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain J 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520 Chain K 18–344（327 aa） Fragment：Ectodomain HA1, residues 18-344 Chain L 345–518（174 aa） Fragment：Ectodomain HA2, residues 345-520	Mutation：G205C, R220C Mutation：G205C, R220C Mutation：G205C, R220C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.8；295.5 K；27% PEG-MME 2000, 0.1M Tris pH 8.8, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 2.00 Å R-free 0.249
3UYW Crystal structures of globular head of 2009 pandemic H1N1 hemagglutinin Deposited 2011-12-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 65–278（214 aa） Fragment：UNP residues 65-278	Not recorded	TAU 2-AMINOETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG 6000, 5% MPD, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.90 Å R-free 0.198
3UYW Crystal structures of globular head of 2009 pandemic H1N1 hemagglutinin Deposited 2011-12-06	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 65–278（214 aa） Fragment：UNP residues 65-278	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG 6000, 5% MPD, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.90 Å R-free 0.198
3UYW Crystal structures of globular head of 2009 pandemic H1N1 hemagglutinin Deposited 2011-12-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 65–278（214 aa） Fragment：UNP residues 65-278	Not recorded	TAU 2-AMINOETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG 6000, 5% MPD, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.90 Å R-free 0.198
3UYW Crystal structures of globular head of 2009 pandemic H1N1 hemagglutinin Deposited 2011-12-06	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 65–278（214 aa） Fragment：UNP residues 65-278	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG 6000, 5% MPD, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.90 Å R-free 0.198
3UYX Crystal structures of globular head of 2009 pandemic H1N1 hemagglutinin Deposited 2011-12-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 65–278（214 aa） Fragment：UNP residues 65-278	Mutation：D228G	NO3 NITRATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；291 K；20% PEG 3350, 0.2M ammonium nitrate, pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.80 Å R-free 0.201
3UYX Crystal structures of globular head of 2009 pandemic H1N1 hemagglutinin Deposited 2011-12-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 65–278（214 aa） Fragment：UNP residues 65-278	Mutation：D228G	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；291 K；20% PEG 3350, 0.2M ammonium nitrate, pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.80 Å R-free 0.201
3ZTN STRUCTURE OF INFLUENZA A NEUTRALIZING ANTIBODY SELECTED FROM CULTURES OF SINGLE HUMAN PLASMA CELLS IN COMPLEX WITH HUMAN H1 INFLUENZA HAEMAGGLUTININ. Deposited 2011-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 18–344（327 aa） Fragment：HA1, RESIDUES 18-344 Chain B 345–520（176 aa） Fragment：HA2, RESIDUES 345-520	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 SO4 SULFATE ION × 15 GOL GLYCEROL × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å R-free 0.289
4JTV Crystal structure of 2009 pandemic influenza virus hemagglutinin complexed with human receptor analogue LSTc Deposited 2013-03-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 18–338（321 aa） Fragment：UNP residues 18-338 Chain B 345–506（162 aa） Fragment：UNP residues 345-506 Chain C 18–338（321 aa） Fragment：UNP residues 18-338 Chain D 345–506（162 aa） Fragment：UNP residues 345-506 Chain E 18–338（321 aa） Fragment：UNP residues 18-338 Chain F 345–506（162 aa） Fragment：UNP residues 345-506	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG6000, 5% MPD, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.00 Å R-free 0.275
4JTV Crystal structure of 2009 pandemic influenza virus hemagglutinin complexed with human receptor analogue LSTc Deposited 2013-03-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 18–338（321 aa） Fragment：UNP residues 18-338 Chain H 345–506（162 aa） Fragment：UNP residues 345-506 Chain I 18–338（321 aa） Fragment：UNP residues 18-338 Chain J 345–506（162 aa） Fragment：UNP residues 345-506 Chain K 18–338（321 aa） Fragment：UNP residues 18-338 Chain L 345–506（162 aa） Fragment：UNP residues 345-506	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 SIA N-acetyl-alpha-neuraminic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG6000, 5% MPD, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.00 Å R-free 0.275
4JTX Crystal structure of 2009 pandemic influenza virus hemagglutinin mutant D225E Deposited 2013-03-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 18–339（322 aa） Fragment：UNP residues 18-339 Chain B 345–510（166 aa） Fragment：UNP residues 345-510 Chain C 18–339（322 aa） Fragment：UNP residues 18-339 Chain D 345–510（166 aa） Fragment：UNP residues 345-510 Chain E 18–339（322 aa） Fragment：UNP residues 18-339 Chain F 345–510（166 aa） Fragment：UNP residues 345-510	Mutation：D228E Mutation：D228E Mutation：D228E	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG 6000, 5% MPD, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.00 Å R-free 0.243
4JTX Crystal structure of 2009 pandemic influenza virus hemagglutinin mutant D225E Deposited 2013-03-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 18–339（322 aa） Fragment：UNP residues 18-339 Chain H 345–510（166 aa） Fragment：UNP residues 345-510 Chain I 18–339（322 aa） Fragment：UNP residues 18-339 Chain J 345–510（166 aa） Fragment：UNP residues 345-510 Chain K 18–339（322 aa） Fragment：UNP residues 18-339 Chain L 345–510（166 aa） Fragment：UNP residues 345-510	Mutation：D228E Mutation：D228E Mutation：D228E	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG 6000, 5% MPD, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.00 Å R-free 0.243
4JU0 Crystal structure of 2009 pandemic influenza virus hemagglutinin mutant D225E complexed with human receptor analogue LSTc Deposited 2013-03-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 18–339（322 aa） Fragment：UNP residues 18-339 Chain B 345–508（164 aa） Fragment：UNP residues 345-508 Chain C 18–339（322 aa） Fragment：UNP residues 18-339 Chain D 345–508（164 aa） Fragment：UNP residues 345-508 Chain E 18–339（322 aa） Fragment：UNP residues 18-339 Chain F 345–508（164 aa） Fragment：UNP residues 345-508	Mutation：D228E Mutation：D228E Mutation：D228E	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG 6000, 5% MPD, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.91 Å R-free 0.283
4JU0 Crystal structure of 2009 pandemic influenza virus hemagglutinin mutant D225E complexed with human receptor analogue LSTc Deposited 2013-03-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 18–339（322 aa） Fragment：UNP residues 18-339 Chain H 345–508（164 aa） Fragment：UNP residues 345-508 Chain I 18–339（322 aa） Fragment：UNP residues 18-339 Chain J 345–508（164 aa） Fragment：UNP residues 345-508 Chain K 18–339（322 aa） Fragment：UNP residues 18-339 Chain L 345–508（164 aa） Fragment：UNP residues 345-508	Mutation：D228E Mutation：D228E Mutation：D228E	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SIA N-acetyl-alpha-neuraminic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；10% PEG 6000, 5% MPD, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.91 Å R-free 0.283
4M4Y Crystal structure of a 2009 H1N1 influenza virus hemagglutinin with a stabilization mutation HA2 E47G Deposited 2013-08-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 18–344（327 aa） Fragment：ectodomain (residues 18-344) Chain B 345–518（174 aa） Fragment：ectodomain (residues 345-518) Chain C 18–344（327 aa） Fragment：ectodomain (residues 18-344) Chain D 345–518（174 aa） Fragment：ectodomain (residues 345-518) Chain E 18–344（327 aa） Fragment：ectodomain (residues 18-344) Chain F 345–518（174 aa） Fragment：ectodomain (residues 345-518)	Mutation：E47G Mutation：E47G Mutation：E47G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.8；295 K；0.1 M Tris, pH 8.8, 25% w/v MPEG2000, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.20 Å R-free 0.232
5GJS Crystal structure of H1 hemagglutinin from A/California/04/2009 in complex with a neutralizing antibody 3E1 Deposited 2016-07-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 18–344（327 aa） Fragment：UNP residues 18-344 Chain B 345–520（176 aa） Fragment：neutralizing antibody 3E1	Mutation：G212C, R227C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M MES and 16% PEG 550MME	Resolution 2.90 Å R-free 0.303
5K9O Crystal structure of multidonor HV1-18+HD3-9 class broadly neutralizing Influenza A antibody 31.b.09 in complex with Hemagglutinin H1 A/California/04/2009 Deposited 2016-06-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 18–520（503 aa） Chain I 18–520（503 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M imidazole, pH 6.5, 0.1M MgCl2, 1.75M NaCl, and 15% PEG-3350	Resolution 3.39 Å R-free 0.346
5WKO Crystal structure of antibody 27F3 recognizing the HA from A/California/04/2009 (H1N1) influenza virus Deposited 2017-07-25	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain M 18–344（327 aa） Chain N 18–344（327 aa） Chain O 18–344（327 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；1.6 M ammonium sulfate, 0.1 M citric acid pH 4.0	Resolution 3.49 Å R-free 0.268
5WKO Crystal structure of antibody 27F3 recognizing the HA from A/California/04/2009 (H1N1) influenza virus Deposited 2017-07-25	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain S 18–344（327 aa） Chain T 18–344（327 aa） Chain U 18–344（327 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；1.6 M ammonium sulfate, 0.1 M citric acid pH 4.0	Resolution 3.49 Å R-free 0.268
7FAH Immune complex of head region of CA09 HA and neutralizing antibody 12H5 Deposited 2021-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 18–518（501 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；0.1M MES pH 6.5, 13% (w/v) PEG 2000	Resolution 3.15 Å R-free 0.289
7FAH Immune complex of head region of CA09 HA and neutralizing antibody 12H5 Deposited 2021-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 18–518（501 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；0.1M MES pH 6.5, 13% (w/v) PEG 2000	Resolution 3.15 Å R-free 0.289
7MEM CryoEM structure of monoclonal Fab 045-09 2B05 binding the lateral patch of influenza virus H1 HA Deposited 2021-04-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 345–518（174 aa） Chain B 345–518（174 aa） Chain C 18–344（327 aa） Chain D 345–518（174 aa） Chain E 18–344（327 aa） Chain F 18–344（327 aa）	Mutation：E47G Mutation：E47G Mutation：E47G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；TBS + LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7T3D CryoEM map of anchor 222-1C06 Fab and lateral patch 2B05 Fab binding H1 HA Deposited 2021-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 18–344（327 aa） Chain B 345–518（174 aa） Chain E 18–344（327 aa） Chain F 18–344（327 aa） Chain G 345–518（174 aa） Chain I 345–518（174 aa）	Mutation：E47K Mutation：E47K Mutation：E47K	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Tris-buffered saline cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.38 Å
8TXM Crystal structure of 05.GC.w13.02 Fab in complex with H1 HA from A/California/04/2009(H1N1) Deposited 2023-08-23	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 18–341（324 aa） Fragment：HA1 subdomain (UNP residues 18-344)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 MG MAGNESIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M sodium acetate, pH 6.2, 20% PEG3350	Resolution 3.25 Å R-free 0.287

21 other PDB entries and 40 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	C3W5S1_I09A0
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–331； UniProt 18–344

Hemagglutinin

Influenza A virus

UniProt I1ZFF9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 15 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain B； UniProt 326–499	Fragment：HA2 subdomain (UNP residues 326-499)	Hemagglutinin × 3 （C3W5S1） GC_w13_A, Fab heavy chain × 3 GC_w13_A, Fab light chain × 3 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 9	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M sodium acetate, pH 6.2, 20% PEG3350	Resolution 2.75 Å R-free 0.292

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8TXP	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8TY7 Crystal structure of 05.GC.w2.3C10 Fab in complex with H1 HA from A/California/04/2009(H1N1) Deposited 2023-08-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 326–499（174 aa） Fragment：HA2 subdomain (UNP residues 326-499)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M sodium acetate, pH 6.4, 18% PEG3350	Resolution 3.21 Å R-free 0.288
9Y3X Crystal structure of hemagglutinin from H1N1 Influenza A virus A/California/04/2009 bound to the 3_H2 antibody Deposited 2025-09-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain F 326–499（174 aa） Fragment：HA2 subdomain (UNP residues 326-499)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.2M Tri-potassium citrate, 20% (w/v) PEG3350, pH 8.3	Resolution 3.39 Å R-free 0.261
9Y3Y Crystal structure of hemagglutinin from H1N1 Influenza A virus A/California/04/2009 bound to the 49_C09 antibody Deposited 2025-09-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 326–499（174 aa） Fragment：HA2 subdomain (UNP residues 326-499)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；2M ammonium sulfate, 15% (v/v) ethylene glycol, 0.2M lithium sulfate, 0.1M CAPS, pH 10.5	Resolution 3.80 Å R-free 0.240
9Y3Y Crystal structure of hemagglutinin from H1N1 Influenza A virus A/California/04/2009 bound to the 49_C09 antibody Deposited 2025-09-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 326–499（174 aa） Fragment：HA2 subdomain (UNP residues 326-499)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；2M ammonium sulfate, 15% (v/v) ethylene glycol, 0.2M lithium sulfate, 0.1M CAPS, pH 10.5	Resolution 3.80 Å R-free 0.240

3 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I1ZFF9_9INFA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–174； UniProt 326–499

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8txp
Deposition date deposition_date	2023-08-24
Structure title title	Crystal structure of 05.GC.w13.01 Fab in complex with H1 HA from A/California/04/2009(H1N1)
Keywords keywords	H1N1, Antibody, Hemagglutinin, VIRAL PROTEIN-IMMUNE SYSTEM complex; VIRAL PROTEIN/IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	40.93 Å
Radius of gyration Rg (electron density) rg_electron	40.88 Å
Forward intensity I(0) i0	173444000.00
Molecular weight molecular_weight	105250.0 kDa
Excluded volume excluded_volume	131030 Å³
Envelope volume envelope_volume	185340 Å³
Hydration-shell volume shell_volume	40291 Å³
Envelope diameter envelope_diameter	140.3 Å
Shell Rg shell_rg	42.90 Å
Envelope Rg envelope_rg	40.31 Å
Shape Rg shape_rg	40.90 Å
Total Rg total_rg	40.95 Å
Total atoms total_atoms	7404
Residues n_residues	930
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	135.2 Å
Rg (real space) rg_real	41.06 Å
Rg uncertainty (real space) rg_real_error	1.33 Å
I(0) (real space) i0_real	1.7340e+08
I(0) uncertainty (real space) i0_real_error	3.2720e+06
Rg (reciprocal space) rg_reciprocal	40.93 Å
I(0) (reciprocal space) i0_reciprocal	173400000.0000
Solution quality estimate total_estimate	0.8538
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	34.7 Å
Skewness Skewness skewness	0.282
Kurtosis Kurtosis kurtosis	-0.722
Angular range angular_range	— – 0.1950 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	14090000.0000
Real-space data points n_real_points	40
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.862; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.768; Smooth: 0.742

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Hemagglutinin
Molecular weight formula_weight	36729.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	7404

ADPGDTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADTYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNIPSIQSR

来源 Source

来源生物 organism	Influenza A virus
NCBI Class编号 ncbi_taxonomy_id	11320
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 2 Entity 2 polymer

Description description	Hemagglutinin
Molecular weight formula_weight	20206.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDSGR

来源 Source

来源生物 organism	Influenza A virus
NCBI Class编号 ncbi_taxonomy_id	11320
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 3 Entity 3 polymer

Description description	GC_w13_A, Fab heavy chain
Molecular weight formula_weight	23561.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

QVQLVQSGAEVKKPGSSVKVSCEASGVTFSSYAVSWVRQAPGQGLEWMGGIIPIVGTANYAQKFQGRVTITADGLTSTVYMELSRLRSEDTAVYFCAREATWKGSSIGVLGIWGQGTMVTVSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Cricetulus griseus

Entity 4 Entity 4 polymer

Description description	GC_w13_A, Fab light chain
Molecular weight formula_weight	23397.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

DIQMTQSPSSLSASVGDRVTITCRASQSISDYLNWYQQKPGKAPSLLIFSASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQNYNTPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

来源 Source

来源生物 organism	Homo sapiens
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Cricetulus griseus

Entity 5 Entity 5 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	2

Entity 6 Entity 6 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	3

▶

8. Citations (1)

▶

Unit-cell length a length_a	128.350 Å
Unit-cell length b length_b	128.350 Å
Unit-cell length c length_c	155.756 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 3 2 1
Space-group number int_tables_number	150
Crystal system crystal_system	—

Resolution resolution	2.750 Å
Low-resolution limit resolution_low	45.240 Å
R factor r_factor	0.2517
R_work r_work	0.2496
R_free r_free	0.2918

fit	/app/data/saxs_computation/tx/8txp/8txp.fit
pddf	/app/data/pr_computation/tx/8txp/8txp.pr.out
profile	/app/data/saxs_computation/tx/8txp/8txp.dat

Crystal structure of 05.GC.w13.01 Fab in complex with H1 HA from A/California/04/2009(H1N1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hemagglutinin

State in the Current Structure

Other States of the Same Protein in the Database

Hemagglutinin

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 branched

Entity 6 Entity 6 branched

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)