SAXSdb — 8u77

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor TFIID subunit 14

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Protein YNG1 × 1 （Q08465） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Protein YNG1 × 1 （Q08465） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Protein YNG1 × 1 （Q08465） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Protein YNG1 × 1 （Q08465） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF14_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–72； UniProt 176–243 Author chain C； PDBConstruct 5–72； UniProt 176–243 Author chain E； PDBConstruct 5–72； UniProt 176–243 Author chain G； PDBConstruct 5–72； UniProt 176–243

Protein YNG1

OrganismNot specified

UniProt Q08465

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Transcription initiation factor TFIID subunit 14 × 1 （P35189） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Transcription initiation factor TFIID subunit 14 × 1 （P35189） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Transcription initiation factor TFIID subunit 14 × 1 （P35189） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Transcription initiation factor TFIID subunit 14 × 1 （P35189） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YNG1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–12； UniProt 113–124 Author chain D； PDBConstruct 1–12； UniProt 113–124 Author chain F； PDBConstruct 1–12； UniProt 113–124 Author chain H； PDBConstruct 1–12； UniProt 113–124

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8u77
Deposition date deposition_date	2023-09-14
Last revision last_revision	2024-08-21
Structure title title	Crystal structure of Taf14 in complex with Yng1
Keywords keywords	Complex, Taf14, Yng1, transcription factor, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8u77__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8u77__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8u77__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	13.84 Å
Rg (electron density)	12.19 Å
Total Rg	13.68 Å
Atom count	638
Residues	80
Excluded volume	11626 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8u77__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8u77__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`8u77__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`8u77__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Transcription initiation factor TFIID subunit 14
Molecular weight formula_weight	8053.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G
Atom count atom_count	2881

SVKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLYSLPEGLLKSLWDYVKKNT

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 2 Entity 2 polymer

Description description	Protein YNG1
Molecular weight formula_weight	1440.9 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H

EPKLLLKINLKK

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	329

▶

Unit-cell length a length_a	46.780 Å
Unit-cell length b length_b	64.610 Å
Unit-cell length c length_c	64.490 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	101.53 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	1.930 Å
Low-resolution limit resolution_low	45.840 Å
R factor r_factor	0.1852
R_work r_work	0.1824
R_free r_free	0.2209

Crystal structure of Taf14 in complex with Yng1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor TFIID subunit 14

State in the Current Structure

Other States of the Same Protein in the Database

Protein YNG1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8u77__assembly_1__model_1

8u77__assembly_1__model_1 | I(q)

8u77__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)

Crystal structure of Taf14 in complex with Yng1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor TFIID subunit 14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein YNG1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8u77__assembly_1__model_1

8u77__assembly_1__model_1 | I(q)

8u77__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)