8vaz

Structure of human Slo1 and human LRRC26 in EDTA - LRRD masked

Method: ELECTRON MICROSCOPY D_max: 157.0 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Calcium-activated potassium channel subunit alpha-1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain A； UniProt 66–1121 Chain B； UniProt 66–1121 Chain C； UniProt 66–1121 Chain D； UniProt 66–1121	Not recorded	Leucine-rich repeat-containing protein 26 × 4 （Q2I0M4） K POTASSIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.82 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8VAZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
10AD Cryo-EM structure of the human BK channel bound to the agonist NS1619 Deposited 2026-01-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 66–1178（1113 aa） Chain C 66–1178（1113 aa） Chain D 66–1178（1113 aa） Chain E 66–1178（1113 aa）	Not recorded	MG MAGNESIUM ION × 4 CA CALCIUM ION × 8 A1E02 3-[2-oxidanyl-5-(trifluoromethyl)phenyl]-6-(trifluoromethyl)-1~{H}-benzimidazol-2-one × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
2K44 Solution structure of a K+-channel voltage-sensor paddle domain Deposited 2008-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 257–284（28 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.5；310 K；Ionic strength (raw mmCIF value) 0.05；Pressure ambient NMR sample composition 100mM [U-2H] 98% DPC, 50mM potassium chloride, 1mM HsapBK(233-260), 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
3NAF Structure of the Intracellular Gating Ring from the Human High-conductance Ca2+ gated K+ Channel (BK Channel) Deposited 2010-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 394–681（288 aa） Fragment：Intracellular Domain (UNP RESIDUES 329-616; 659-1113) Chain A 786–1240（455 aa） Fragment：Intracellular Domain (UNP RESIDUES 329-616; 659-1113)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；3.5M sodium formate, 0.1M Tris-HCl, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.10 Å R-free 0.289
6ND0 human BK channel reconstituted into liposomes Deposited 2018-12-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 292–1175（884 aa） Chain B 292–1175（884 aa） Chain C 292–1175（884 aa） Chain D 292–1175（884 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE；BK proteoliposomes were applied onto a glow-discharged perforated carbon grid (CFlat R2/2, EMS), and incubated for 5-10 min In an FEI Vitrobot Mark IV (FEI). After incubation, the sample was blotted from the side and buffer containing 10 mM HEPES, pH 7.3, 75 mM KCl, and 1 mM EDTA was applied onto the TEM grid to further swell proteoliposomes. Then grids were blotted for 7 s with force 0 and fast frozen in liquid ethane cooled by liquid nitrogen.	Resolution 3.50 Å
6V22 Cryo-EM structure of Ca2+-bound hsSlo1-beta4 channel complex Deposited 2019-11-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 66–1121（1056 aa） Fragment：UNP residues 66-1121 Chain B 66–1121（1056 aa） Fragment：UNP residues 66-1121 Chain C 66–1121（1056 aa） Fragment：UNP residues 66-1121 Chain D 66–1121（1056 aa） Fragment：UNP residues 66-1121	Not recorded	MG MAGNESIUM ION × 4 CA CALCIUM ION × 8 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 60 CLR CHOLESTEROL × 16 K POTASSIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot for 4 seconds before plunging.	Resolution 3.20 Å
6V35 Cryo-EM structure of Ca2+-free hsSlo1-beta4 channel complex Deposited 2019-11-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Not recorded	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 40 CLR CHOLESTEROL × 8 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot for 4 seconds before plunging.	Resolution 3.50 Å
6V38 Cryo-EM structure of Ca2+-bound hsSlo1 channel Deposited 2019-11-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Not recorded	MG MAGNESIUM ION × 4 CA CALCIUM ION × 8 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 32 CLR CHOLESTEROL × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot for 4 seconds before plunging.	Resolution 3.80 Å
6V3G Cryo-EM structure of Ca2+-free hsSlo1 channel Deposited 2019-11-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot for 4 seconds before plunging.	Resolution 4.00 Å
6V5A Crystal structure of the human BK channel gating ring L390P mutant Deposited 2019-12-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 406–1121（716 aa） Fragment：Gating Ring	Mutation：L390P	CA CALCIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.9；295 K；50 mM sodium acetate, 4% (w/v) PEG 4000, 100 mM sodium sulfate, and 100 mM lithium sulfate (pH 4.9)	Resolution 2.00 Å R-free 0.226
8GH9 Cryo-EM structure of hSlo1 in total membrane vesicles Deposited 2023-03-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 67–1121（1055 aa） Chain B 67–1121（1055 aa） Chain C 67–1121（1055 aa） Chain D 67–1121（1055 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
8GHF cryo-EM structure of hSlo1 in plasma membrane vesicles Deposited 2023-03-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 67–1121（1055 aa） Chain B 67–1121（1055 aa） Chain C 67–1121（1055 aa） Chain D 67–1121（1055 aa）	Not recorded	MG MAGNESIUM ION × 4 CA CALCIUM ION × 8 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 88 CLR CHOLESTEROL × 24 NA SODIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8GHG Cryo-EM structure of hSlo1 in digitonin, Ca2+-free and EDTA-free Deposited 2023-03-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 67–1121（1055 aa） Chain B 67–1121（1055 aa） Chain C 67–1121（1055 aa） Chain D 67–1121（1055 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8V60 F315A mutant of human Slo1 in presence of EDTA - resting VSD Deposited 2023-12-01	Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Mutation：F315A Mutation：F315A Mutation：F315A Mutation：F315A	K POTASSIUM ION × 9 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 28 CLR CHOLESTEROL × 4 AJP Digitonin × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.43 Å
8V63 R207A mutant of human Slo1 in presence of EDTA - activated VSD Deposited 2023-12-01	Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Mutation：R207A Mutation：R207A Mutation：R207A Mutation：R207A	K POTASSIUM ION × 9 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 28 CLR CHOLESTEROL × 4 AJP Digitonin × 40	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.72 Å
8V64 RCK1-RCK2 double mutant of human Slo1 in presence of EDTA - resting VSD Deposited 2023-12-01	Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Mutation：D894A,D895A,D896A,D897A Mutation：D894A,D895A,D896A,D897A Mutation：D894A,D895A,D896A,D897A Mutation：D894A,D895A,D896A,D897A	K POTASSIUM ION × 9 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 24 CLR CHOLESTEROL × 4 AJP Digitonin × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
8VAV Human Slo1 - human LRRC26 in presence of EDTA - GR masked Deposited 2023-12-11	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Not recorded	POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 20 K POTASSIUM ION × 4 AJP Digitonin × 32 CLR CHOLESTEROL × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.13 Å
8Z3S Activation mechanism and novel binding site of the BKCa channel activator CTIBD Deposited 2024-04-16	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 66–1179（1114 aa） Chain B 66–1179（1114 aa） Chain C 66–1179（1114 aa） Chain D 66–1179（1114 aa）	Not recorded	A1L04 4-[4-(4-chlorophenyl)-3-(trifluoromethyl)-1,2-oxazol-5-yl]benzene-1,3-diol × 8 Y01 CHOLESTEROL HEMISUCCINATE × 4 MG MAGNESIUM ION × 4 CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9CZH Ca2+ bound intermediate state of hSlo1 + beta2N-beta4 channel in detergent. Deposited 2024-08-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Not recorded	CA CALCIUM ION × 8 K POTASSIUM ION × 4 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl pH 8.0, 450 mM KCl, 5 mM EDTA, 15 mM MgCl2, 0.02% GDN and 0.05 mg/ml POPE:POPC:POPA 5:5:1 (w:w:w). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9CZJ Ca2+ free hSlo1 + beta2N-beta4 channel in detergent. Deposited 2024-08-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Not recorded	CLR CHOLESTEROL × 4 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl pH 8.0, 450 mM KCl, 5 mM EDTA, 15 mM MgCl2, 0.02% GDN and 0.05 mg/ml POPE:POPC:POPA 5:5:1 (w:w:w). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.54 Å
9CZK Ca2+ free hSlo1 + beta2N-beta4 channel in nanodisc. Deposited 2024-08-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Not recorded	K POTASSIUM ION × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 4 CLR CHOLESTEROL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl pH 8.0, 450 mM KCl, 5 mM EDTA, 15 mM MgCl2, 0.02% GDN and 0.05 mg/ml POPE:POPC:POPA 5:5:1 (w:w:w). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9CZM Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in nanodisc. Deposited 2024-08-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Not recorded	POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 32 MG MAGNESIUM ION × 4 CA CALCIUM ION × 8 CLR CHOLESTEROL × 8 K POTASSIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl pH 8.0, 450 mM KCl, 5 mM EDTA, 15 mM MgCl2, 0.02% GDN and 0.05 mg/ml POPE:POPC:POPA 5:5:1 (w:w:w). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.57 Å
9CZO Ca2+ bound intermediate state of hSlo1 + beta2N-beta4 channel in nanodisc. Deposited 2024-08-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Not recorded	CA CALCIUM ION × 8 K POTASSIUM ION × 4 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl pH 8.0, 450 mM KCl, 5 mM EDTA, 15 mM MgCl2, 0.02% GDN and 0.05 mg/ml POPE:POPC:POPA 5:5:1 (w:w:w). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.87 Å
9CZQ Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in detergent. Deposited 2024-08-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Not recorded	MG MAGNESIUM ION × 4 CA CALCIUM ION × 8 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 20 CLR CHOLESTEROL × 11 K POTASSIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl pH 8.0, 450 mM KCl, 5 mM EDTA, 15 mM MgCl2, 0.02% GDN and 0.05 mg/ml POPE:POPC:POPA 5:5:1 (w:w:w). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.88 Å
9D18 Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in detergent-conformation 2 of inactivating domain Deposited 2024-08-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Not recorded	MG MAGNESIUM ION × 4 CA CALCIUM ION × 8 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 20 CLR CHOLESTEROL × 11 K POTASSIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl pH 8.0, 450 mM KCl, 5 mM EDTA, 15 mM MgCl2, 0.02% GDN and 0.05 mg/ml POPE:POPC:POPA 5:5:1 (w:w:w). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.88 Å
9D19 Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in detergent-conformation 3 of inactivating domain Deposited 2024-08-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 66–1121（1056 aa） Chain B 66–1121（1056 aa） Chain C 66–1121（1056 aa） Chain D 66–1121（1056 aa）	Not recorded	MG MAGNESIUM ION × 4 CA CALCIUM ION × 8 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 20 CLR CHOLESTEROL × 11 K POTASSIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl pH 8.0, 450 mM KCl, 5 mM EDTA, 15 mM MgCl2, 0.02% GDN and 0.05 mg/ml POPE:POPC:POPA 5:5:1 (w:w:w). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.88 Å
9JO3 Cryo-EM structure of human BKca channel-compound 10b complex Deposited 2024-09-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 66–1184（1119 aa） Chain B 66–1184（1119 aa） Chain C 66–1184（1119 aa） Chain D 66–1184（1119 aa）	Not recorded	MG MAGNESIUM ION × 4 CA CALCIUM ION × 8 K POTASSIUM ION × 3 A1L4E 5-azanyl-2-[2,3,5,6-tetrakis(fluoranyl)-4-(trifluoromethyl)phenoxy]phenol × 4 Y01 CHOLESTEROL HEMISUCCINATE × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9JO4 Cryo-EM structure of human BKca channel-compound 51b complex Deposited 2024-09-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 66–1179（1114 aa） Chain B 66–1179（1114 aa） Chain C 66–1179（1114 aa） Chain D 66–1179（1114 aa）	Not recorded	A1L4F 5-(5-morpholin-4-ylpentylamino)-2-[2,3,5,6-tetrakis(fluoranyl)-4-(trifluoromethyl)phenoxy]phenol × 4 MG MAGNESIUM ION × 4 CA CALCIUM ION × 8 K POTASSIUM ION × 3 Y01 CHOLESTEROL HEMISUCCINATE × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å

27 other PDB entries and 27 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KCMA1_HUMAN
Isoform	Q12791-5
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1056； UniProt 66–1121 Author chain B； PDBConstruct 1–1056； UniProt 66–1121 Author chain C； PDBConstruct 1–1056； UniProt 66–1121 Author chain D； PDBConstruct 1–1056； UniProt 66–1121

Leucine-rich repeat-containing protein 26

Homo sapiens

UniProt Q2I0M4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain E； UniProt 1–334 Chain F； UniProt 1–334 Chain G； UniProt 1–334 Chain H； UniProt 1–334	Not recorded	Calcium-activated potassium channel subunit alpha-1 × 4 （Q12791） K POTASSIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.82 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8VAZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7YNZ Cryo-EM structure of human Slo1-LRRC26 complex with C1 symmetry Deposited 2022-08-01	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–334（334 aa） Chain D 1–334（334 aa） Chain F 1–334（334 aa） Chain H 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 4 CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7YO0 Cryo-EM structure of human Slo1-LRRC26 complex with Symmetry Expansion Deposited 2022-08-01	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–334（334 aa） Chain D 1–334（334 aa） Chain F 1–334（334 aa） Chain H 1–334（334 aa）	Not recorded	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4 MG MAGNESIUM ION × 4 CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7YO1 Cryo-EM structure of RCK1 mutated human Slo1-LRRC26 complex Deposited 2022-08-01	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–334（334 aa） Chain D 1–334（334 aa） Chain F 1–334（334 aa） Chain H 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 4 CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7YO3 Cryo-EM structure of human Slo1-LRRC26 complex with C4 symmetry Deposited 2022-08-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 1 CA CALCIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7YO4 Cryo-EM structure of RCK1-RCK2 mutated human Slo1-LRRC26 complex Deposited 2022-08-01	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–334（334 aa） Chain D 1–334（334 aa） Chain F 1–334（334 aa） Chain H 1–334（334 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
8VAV Human Slo1 - human LRRC26 in presence of EDTA - GR masked Deposited 2023-12-11	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–334（334 aa） Chain F 1–334（334 aa） Chain G 1–334（334 aa） Chain H 1–334（334 aa）	Not recorded	POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 20 K POTASSIUM ION × 4 AJP Digitonin × 32 CLR CHOLESTEROL × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.13 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LRC26_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–334； UniProt 1–334 Author chain F； PDBConstruct 1–334； UniProt 1–334 Author chain G； PDBConstruct 1–334； UniProt 1–334 Author chain H； PDBConstruct 1–334； UniProt 1–334

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8vaz
Deposition date deposition_date	2023-12-11
Structure title title	Structure of human Slo1 and human LRRC26 in EDTA - LRRD masked
Keywords keywords	Slo1, BK, maxiK, potassium channel, voltage sensor, VSD, resting state, LRRC26, Gamma1, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	51.92 Å
Radius of gyration Rg (electron density) rg_electron	51.35 Å
Forward intensity I(0) i0	2249020000.00
Molecular weight molecular_weight	417660.0 kDa
Excluded volume excluded_volume	530520 Å³
Envelope volume envelope_volume	778390 Å³
Hydration-shell volume shell_volume	120590 Å³
Envelope diameter envelope_diameter	156.9 Å
Shell Rg shell_rg	59.96 Å
Envelope Rg envelope_rg	49.67 Å
Shape Rg shape_rg	51.35 Å
Total Rg total_rg	51.61 Å
Total atoms total_atoms	29404
Residues n_residues	3704
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	157.0 Å
Rg (real space) rg_real	51.60 Å
Rg uncertainty (real space) rg_real_error	1.36 Å
I(0) (real space) i0_real	2.2490e+09
I(0) uncertainty (real space) i0_real_error	4.2740e+07
Rg (reciprocal space) rg_reciprocal	52.18 Å
I(0) (reciprocal space) i0_reciprocal	2251000000.0000
Solution quality estimate total_estimate	0.8844
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	73.3 Å
Skewness Skewness skewness	-0.028
Kurtosis Kurtosis kurtosis	-0.566
Angular range angular_range	— – 0.1500 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	287500000.0000
Real-space data points n_real_points	31
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.915; Stabil: 0.997; Sysdev: 1.000; Positv: 1.000; Valcen: 0.957; Smooth: 0.798

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Calcium-activated potassium channel subunit alpha-1
Molecular weight formula_weight	119988.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	29404

MDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDSNSLEVLFQ

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Leucine-rich repeat-containing protein 26
Molecular weight formula_weight	35893.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

MRGPSWSRPRPLLLLLLLLSPWPVWAQVSATASPSGSLGAPDCPEVCTCVPGGLASCSALSLPAVPPGLSLRLRALLLDHNRVRALPPGAFAGAGALQRLDLRENGLHSVHVRAFWGLGALQLLDLSANQLEALAPGTFAPLRALRNLSLAGNRLARLEPAALGALPLLRSLSLQDNELAALAPGLLGRLPALDALHLRGNPWGCGCALRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLALRDLAVVYTLGPASFLVSLASCLALGSGLTACRARRRRLRTAALRPPRPPDPNPDPDPHGCASPADPGSPAAAAQAAAAGLEVLFQ

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 3 Entity 3 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	4

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.82 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	340094

fit	/app/data/saxs_computation/va/8vaz/8vaz.fit
pddf	/app/data/pr_computation/va/8vaz/8vaz.pr.out
profile	/app/data/saxs_computation/va/8vaz/8vaz.dat

Structure of human Slo1 and human LRRC26 in EDTA - LRRD masked

1. Protein Identity and Related Structures Protein Identity & Related Structures

Calcium-activated potassium channel subunit alpha-1

State in the Current Structure

Other States of the Same Protein in the Database

Leucine-rich repeat-containing protein 26

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)