SAXSdb — 8xcg

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail tip protein M

Escherichia phage Lambda

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Tip attachment protein J × 3 （P03749） Tail tip assembly protein I × 3 （P03730） Tail tip protein L × 3 （P03738） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIPM_LAMBD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 1–109； UniProt 1–109 Author chain K； PDBConstruct 1–109； UniProt 1–109 Author chain M； PDBConstruct 1–109； UniProt 1–109 Author chain Y； PDBConstruct 1–109； UniProt 1–109 Author chain e； PDBConstruct 1–109； UniProt 1–109 Author chain m； PDBConstruct 1–109； UniProt 1–109

Tip attachment protein J

Escherichia phage Lambda

UniProt P03749

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Tail tip protein M × 6 （P03737） Tail tip assembly protein I × 3 （P03730） Tail tip protein L × 3 （P03738） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIPJ_LAMBD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 1–1132； UniProt 1–1132 Author chain J； PDBConstruct 1–1132； UniProt 1–1132 Author chain Z； PDBConstruct 1–1132； UniProt 1–1132

Tail tip assembly protein I

Escherichia phage Lambda

UniProt P03730

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Tail tip protein M × 6 （P03737） Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIPI_LAMBD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain I； PDBConstruct 1–223； UniProt 1–223 Author chain P； PDBConstruct 1–223； UniProt 1–223 Author chain h； PDBConstruct 1–223； UniProt 1–223

Tail tip protein L

Escherichia phage Lambda

UniProt P03738

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Tail tip protein M × 6 （P03737） Tip attachment protein J × 3 （P03749） Tail tip assembly protein I × 3 （P03730） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIPL_LAMBD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain L； PDBConstruct 1–232； UniProt 1–232 Author chain N； PDBConstruct 1–232； UniProt 1–232 Author chain f； PDBConstruct 1–232； UniProt 1–232

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8xcg
Deposition date deposition_date	2023-12-09
Structure title title	Tail tip complex of bacteriophage lambda in the open state
Keywords keywords	Bacteriophage, caudovirales, siphoviridae, phage lambda, host recognition, LamB, cryo-EM, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8xcg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8xcg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8xcg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.58 Å
Rg (electron density)	49.04 Å
Total Rg	49.33 Å
Atom count	25941
Residues	3312
Excluded volume	457850 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8xcg__assembly_1__model_1`	pentadecameric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Tail tip protein M
Molecular weight formula_weight	12547.4 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,K,M,Y,e,m
Atom count atom_count	25941

MKTFRWKVKPGMDVASVPSVRKVRFGDGYSQRAPAGLNANLKTYSVTLSVPREEATVLESFLEEHGGWKSFLWTPPYEWRQIKVTCAKWSSRVSMLRVEFSAEFEQVVN

Source Source

Source organism organism	Escherichia phage Lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Tip attachment protein J
Molecular weight formula_weight	124550.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,J,Z

MGKGSSKGHTPREAKDNLKSTQLLSVIDAISEGPIEGPVDGLKSVLLNSTPVLDTEGNTNISGVTVVFRAGEQEQTPPEGFESSGSETVLGTEVKYDTPITRTITSANIDRLRFTFGVQALVETTSKGDRNPSEVRLLVQIQRNGGWVTEKDITIKGKTTSQYLASVVMGNLPPRPFNIRMRRMTPDSTTDQLQNKTLWSSYTEIIDVKQCYPNTALVGVQVDSEQFGSQQVSRNYHLRGRILQVPSNYNPQTRQYSGIWDGTFKPAYSNNMAWCLWDMLTHPRYGMGKRLGAADVDKWALYVIGQYCDQSVPDGFGGTEPRITCNAYLTTQRKAWDVLSDFCSAMRCMPVWNGQTLTFVQDRPSDKTWTYNRSNVVMPDDGAPFRYSFSALKDRHNAVEVNWIDPNNGWETATELVEDTQAIARYGRNVTKMDAFGCTSRGQAHRAGLWLIKTELLETQTVDFSVGAEGLRHVPGDVIEICDDDYAGISTGGRVLAVNSQTRTLTLDREITLPSSGTALISLVDGSGNPVSVEVQSVTDGVKVKVSRVPDGVAEYSVWELKLPTLRQRLFRCVSIRENDDGTYAITAVQHVPEKEAIVDNGAHFDGEQSGTVNGVTPPAVQHLTAEVTADSGEYQVLARWDTPKVVKGVSFLLRLTVTADDGSERLVSTARTTETTYRFTQLALGNYRLTVRAVNAWGQQGDPASVSFRIAAPAAPSRIELTPGYFQITATPHLAVYDPTVQFEFWFSEKQIADIRQVETSTRYLGTALYWIAASINIKPGHDYYFYIRSVNTVGKSAFVEAVGRASDDAEGYLDFFKGKITESHLGKELLEKVELTEDNASRLEEFSKEWKDASDKWNAMWAVKIEQTKDGKHYVAGIGLSMEDTEEGKLSQFLVAANRIAFIDPANGNETPMFVAQGNQIFMNDVFLKRLTAPTITSGGNPPAFSLTPDGKLTAKNADISGSVNANSGTLSNVTIAENCTINGTLRAEKIVGDIVKAASAAFPRQRESSVDWPSGTRTVTVTDDHPFDRQIVVLPLTFRGSKRTVSGRTTYSMCYLKVLMNGAVIYDGAANEAVQVFSRIVDMPAGRGNVILTFTLTSTRHSADIPPYTFASDVQVMVIKKQALGISVV

Source Source

Source organism organism	Escherichia phage Lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Tail tip assembly protein I
Molecular weight formula_weight	23146.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,P,h

MAATHTLPLASPGMARICLYGDLQRFGRRIDLRVKTGAEAIRALATQLPAFRQKLSDGWYQVRIAGRDVSTSGLTAQLHETLPDGAVIHIVPRVAGAKSGGVFQIVLGAAAIAGSFFTAGATLAAWGAAIGAGGMTGILFSLGASMVLGGVAQMLAPKARTPRIQTTDNGKQNTYFSSLDNMVAQGNVLPVLYGEMRVGSRVVSQEISTADEGDGGQVVVIGR

Source Source

Source organism organism	Escherichia phage Lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Tail tip protein L
Molecular weight formula_weight	25730.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,N,f

MQDIRQETLNECTRAEQSASVVLWEIDLTEVGGERYFFCNEQNEKGEPVTWQGRQYQPYPIQGSGFELNGKGTSTRPTLTVSNLYGMVTGMAEDMQSLVGGTVVRRKVYARFLDAVNFVNGNSYADPEQEVISRWRIEQCSELSAVSASFVLSTPTETDGAVFPGRIMLANTCTWTYRGDECGYSGPAVADEYDQPTSDITKDKCSKCLSGCKFRNNVGNFGGFLSINKLSQ

Source Source

Source organism organism	Escherichia phage Lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.46 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	358235

Tail tip complex of bacteriophage lambda in the open state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail tip protein M

State in the Current Structure

Other States of the Same Protein in the Database

Tip attachment protein J

State in the Current Structure

Other States of the Same Protein in the Database

Tail tip assembly protein I

State in the Current Structure

Other States of the Same Protein in the Database

Tail tip protein L

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8xcg__assembly_1__model_1

8xcg__assembly_1__model_1 | I(q)

8xcg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

7. Citations (1)

Tail tip complex of bacteriophage lambda in the open state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail tip protein M

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tip attachment protein J

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tip assembly protein I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tip protein L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8xcg__assembly_1__model_1

8xcg__assembly_1__model_1 | I(q)

8xcg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

7. Citations (1)