SAXSdb — 9oik

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HepS-H105A

Salmonella enterica subsp. enterica serovar Typhimurium str. ATCC 14028

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8	J tail tip × 4 （P03749,Q12306） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F6B549_SALT1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–213； UniProt 1–210 Author chain B； PDBConstruct 4–213； UniProt 1–210

J tail tip

Escherichia phage Lambda

UniProt P03749

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8	HepS-H105A × 4 （A0A0F6B549） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIPJ_LAMBD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 125–156； UniProt 902–933 Author chain D； PDBConstruct 125–156； UniProt 902–933

J tail tip

Escherichia phage Lambda

UniProt Q12306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8	HepS-H105A × 4 （A0A0F6B549） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMT3_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 25–122； UniProt 1–98 Author chain D； PDBConstruct 25–122； UniProt 1–98

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9oik
Deposition date deposition_date	2025-05-06
Structure title title	Structure of S. Typhimurium 14028 Gifsy-1 prophage HepS bound to bacteriophage lambda J Tail Tip
Keywords keywords	tail tip protein, HepS, HEPN, tRNase, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9oik__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9oik__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9oik__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	36.07 Å
Rg (electron density)	35.03 Å
Total Rg	35.58 Å
Atom count	7430
Residues	944
Excluded volume	133960 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9oik__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	HepS-H105A
Molecular weight formula_weight	25496.3 kDa
Mutation mutation	H105A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4239

MGSMKYSRVEQSTGTSIDHNLGYFLDPQKYVPITEFVDESAALIKLNLIHENFLSIVIENLRREGTEKFVDVDKYFMPKIKTAVALGLPVSLAKCLTEMNNIRNKYAAKIEYIITDEDAERIDSLIMSVPVDDINHASLIDSTLITSITNLGASSIAFMNDIPKDFPDNRRRICKLVAMAFCISNLGAFWLLNELHRQGKLKMGSTKMAFKPSAAASAAGDYKDDDDK

Source Source

Source organism organism	Salmonella enterica subsp. enterica serovar Typhimurium str. ATCC 14028
NCBI taxonomy ID ncbi_taxonomy_id	1299114
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	J tail tip
Molecular weight formula_weight	17916.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MGHHHHHHHHHHSSGHIEGRHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGSMIAFIDPANGNETPMFVAQGNQIFMNDVFLKRL

Source Source

Source organism organism	Escherichia phage Lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	524

▶

Unit-cell length a length_a	78.190 Å
Unit-cell length b length_b	93.878 Å
Unit-cell length c length_c	92.456 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	110.81 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	monoclinic

Resolution resolution	1.857 Å
Low-resolution limit resolution_low	43.210 Å
R factor r_factor	0.1842
R_work r_work	0.1830
R_free r_free	0.2093

Structure of S. Typhimurium 14028 Gifsy-1 prophage HepS bound to bacteriophage lambda J Tail Tip

1. Protein Identity and Related Structures Protein Identity & Related Structures

HepS-H105A

State in the Current Structure

Other States of the Same Protein in the Database

J tail tip

State in the Current Structure

Other States of the Same Protein in the Database

J tail tip

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9oik__assembly_1__model_1

9oik__assembly_1__model_1 | I(q)

9oik__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)

Structure of S. Typhimurium 14028 Gifsy-1 prophage HepS bound to bacteriophage lambda J Tail Tip

1. Protein Identity and Related Structures Protein Identity & Related Structures

HepS-H105A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

J tail tip

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

J tail tip

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9oik__assembly_1__model_1

9oik__assembly_1__model_1 | I(q)

9oik__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)