8z5x

Cryo-EM structure of the MS ring with the proximal rod and the export apparatus (C1) within the polar flagellar motor

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthetic protein FliP

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 111	Flagellar M-ring protein × 72 （Q75N27） Flagellar biosynthetic protein FliQ × 4 （A0A0T7EAU9） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar hook-basal body complex protein FliE × 6 （A0A2L2K9J6） Flagellar biosynthetic protein FlhB × 1 （A0AAE4M6S6） Alanine-modelled FlgB-Dc loop × 5 FliE-helix 1 × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1W6TTE6_VIBAL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–289； UniProt 1–289 Author chain 9； PDBConstruct 1–289； UniProt 1–289 Author chain AP； PDBConstruct 1–289； UniProt 1–289 Author chain Ak； PDBConstruct 1–289； UniProt 1–289 Author chain Al； PDBConstruct 1–289； UniProt 1–289

Flagellar M-ring protein

OrganismNot specified

UniProt Q75N27

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 111	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0T7EAU9） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar hook-basal body complex protein FliE × 6 （A0A2L2K9J6） Flagellar biosynthetic protein FlhB × 1 （A0AAE4M6S6） Alanine-modelled FlgB-Dc loop × 5 FliE-helix 1 × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75N27_VIBAL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–580； UniProt 1–580 Author chain 2； PDBConstruct 1–580； UniProt 1–580 Author chain 3； PDBConstruct 1–580； UniProt 1–580 Author chain 4； PDBConstruct 1–580； UniProt 1–580 Author chain 5； PDBConstruct 1–580； UniProt 1–580 Author chain A； PDBConstruct 1–580； UniProt 1–580 Author chain AA； PDBConstruct 1–580； UniProt 1–580 Author chain AB； PDBConstruct 1–580； UniProt 1–580 Author chain AC； PDBConstruct 1–580； UniProt 1–580 Author chain AD； PDBConstruct 1–580； UniProt 1–580 Author chain AE； PDBConstruct 1–580； UniProt 1–580 Author chain AF； PDBConstruct 1–580； UniProt 1–580 Author chain AG； PDBConstruct 1–580； UniProt 1–580 Author chain AH； PDBConstruct 1–580； UniProt 1–580 Author chain AI； PDBConstruct 1–580； UniProt 1–580 Author chain AJ； PDBConstruct 1–580； UniProt 1–580 Author chain AK； PDBConstruct 1–580； UniProt 1–580 Author chain AL； PDBConstruct 1–580； UniProt 1–580 Author chain AM； PDBConstruct 1–580； UniProt 1–580 Author chain AN； PDBConstruct 1–580； UniProt 1–580 Author chain AO； PDBConstruct 1–580； UniProt 1–580 Author chain B； PDBConstruct 1–580； UniProt 1–580 Author chain C； PDBConstruct 1–580； UniProt 1–580 Author chain D； PDBConstruct 1–580； UniProt 1–580 Author chain E； PDBConstruct 1–580； UniProt 1–580 Author chain F； PDBConstruct 1–580； UniProt 1–580 Author chain G； PDBConstruct 1–580； UniProt 1–580 Author chain H； PDBConstruct 1–580； UniProt 1–580 Author chain I； PDBConstruct 1–580； UniProt 1–580 Author chain J； PDBConstruct 1–580； UniProt 1–580 Author chain K； PDBConstruct 1–580； UniProt 1–580 Author chain L； PDBConstruct 1–580； UniProt 1–580 Author chain M； PDBConstruct 1–580； UniProt 1–580 Author chain N； PDBConstruct 1–580； UniProt 1–580 Author chain O； PDBConstruct 1–580； UniProt 1–580 Author chain P； PDBConstruct 1–580； UniProt 1–580 Author chain Q； PDBConstruct 1–580； UniProt 1–580 Author chain R； PDBConstruct 1–580； UniProt 1–580 Author chain S； PDBConstruct 1–580； UniProt 1–580 Author chain T； PDBConstruct 1–580； UniProt 1–580 Author chain U； PDBConstruct 1–580； UniProt 1–580 Author chain V； PDBConstruct 1–580； UniProt 1–580 Author chain W； PDBConstruct 1–580； UniProt 1–580 Author chain X； PDBConstruct 1–580； UniProt 1–580 Author chain Y； PDBConstruct 1–580； UniProt 1–580 Author chain Z； PDBConstruct 1–580； UniProt 1–580 Author chain a； PDBConstruct 1–580； UniProt 1–580 Author chain b； PDBConstruct 1–580； UniProt 1–580 Author chain c； PDBConstruct 1–580； UniProt 1–580 Author chain d； PDBConstruct 1–580； UniProt 1–580 Author chain e； PDBConstruct 1–580； UniProt 1–580 Author chain f； PDBConstruct 1–580； UniProt 1–580 Author chain g； PDBConstruct 1–580； UniProt 1–580 Author chain h； PDBConstruct 1–580； UniProt 1–580 Author chain i； PDBConstruct 1–580； UniProt 1–580 Author chain j； PDBConstruct 1–580； UniProt 1–580 Author chain k； PDBConstruct 1–580； UniProt 1–580 Author chain l； PDBConstruct 1–580； UniProt 1–580 Author chain m； PDBConstruct 1–580； UniProt 1–580 Author chain n； PDBConstruct 1–580； UniProt 1–580 Author chain o； PDBConstruct 1–580； UniProt 1–580 Author chain p； PDBConstruct 1–580； UniProt 1–580 Author chain q； PDBConstruct 1–580； UniProt 1–580 Author chain r； PDBConstruct 1–580； UniProt 1–580 Author chain s； PDBConstruct 1–580； UniProt 1–580 Author chain t； PDBConstruct 1–580； UniProt 1–580 Author chain u； PDBConstruct 1–580； UniProt 1–580 Author chain v； PDBConstruct 1–580； UniProt 1–580 Author chain w； PDBConstruct 1–580； UniProt 1–580 Author chain x； PDBConstruct 1–580； UniProt 1–580 Author chain y； PDBConstruct 1–580； UniProt 1–580 Author chain z； PDBConstruct 1–580； UniProt 1–580

Flagellar biosynthetic protein FliQ

OrganismNot specified

UniProt A0A0T7EAU9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 111	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar M-ring protein × 72 （Q75N27） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar hook-basal body complex protein FliE × 6 （A0A2L2K9J6） Flagellar biosynthetic protein FlhB × 1 （A0AAE4M6S6） Alanine-modelled FlgB-Dc loop × 5 FliE-helix 1 × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0T7EAU9_9VIBR
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 6； PDBConstruct 1–89； UniProt 1–89 Author chain 7； PDBConstruct 1–89； UniProt 1–89 Author chain AQ； PDBConstruct 1–89； UniProt 1–89 Author chain AR； PDBConstruct 1–89； UniProt 1–89

Flagellar biosynthetic protein FliR

OrganismNot specified

UniProt A0A0H0YFV7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 111	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar M-ring protein × 72 （Q75N27） Flagellar biosynthetic protein FliQ × 4 （A0A0T7EAU9） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar hook-basal body complex protein FliE × 6 （A0A2L2K9J6） Flagellar biosynthetic protein FlhB × 1 （A0AAE4M6S6） Alanine-modelled FlgB-Dc loop × 5 FliE-helix 1 × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H0YFV7_VIBAL
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 8； PDBConstruct 1–260； UniProt 1–260

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt A0A0G9LZG6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 111	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar M-ring protein × 72 （Q75N27） Flagellar biosynthetic protein FliQ × 4 （A0A0T7EAU9） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar hook-basal body complex protein FliE × 6 （A0A2L2K9J6） Flagellar biosynthetic protein FlhB × 1 （A0AAE4M6S6） Alanine-modelled FlgB-Dc loop × 5 FliE-helix 1 × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G9LZG6_VIBAL
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AS； PDBConstruct 1–131； UniProt 1–131 Author chain AT； PDBConstruct 1–131； UniProt 1–131 Author chain AU； PDBConstruct 1–131； UniProt 1–131 Author chain AV； PDBConstruct 1–131； UniProt 1–131 Author chain AW； PDBConstruct 1–131； UniProt 1–131

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt A0A0G9LZH2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 111	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar M-ring protein × 72 （Q75N27） Flagellar biosynthetic protein FliQ × 4 （A0A0T7EAU9） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar hook-basal body complex protein FliE × 6 （A0A2L2K9J6） Flagellar biosynthetic protein FlhB × 1 （A0AAE4M6S6） Alanine-modelled FlgB-Dc loop × 5 FliE-helix 1 × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G9LZH2_VIBAL
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AX； PDBConstruct 1–137； UniProt 1–137 Author chain AY； PDBConstruct 1–137； UniProt 1–137 Author chain AZ； PDBConstruct 1–137； UniProt 1–137 Author chain Aa； PDBConstruct 1–137； UniProt 1–137 Author chain Ab； PDBConstruct 1–137； UniProt 1–137 Author chain Ac； PDBConstruct 1–137； UniProt 1–137

Flagellar hook-basal body complex protein FliE

OrganismNot specified

UniProt A0A2L2K9J6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 111	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar M-ring protein × 72 （Q75N27） Flagellar biosynthetic protein FliQ × 4 （A0A0T7EAU9） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar biosynthetic protein FlhB × 1 （A0AAE4M6S6） Alanine-modelled FlgB-Dc loop × 5 FliE-helix 1 × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2L2K9J6_9VIBR
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Ad； PDBConstruct 1–103； UniProt 1–103 Author chain Ae； PDBConstruct 1–103； UniProt 1–103 Author chain Af； PDBConstruct 1–103； UniProt 1–103 Author chain Ag； PDBConstruct 1–103； UniProt 1–103 Author chain Ah； PDBConstruct 1–103； UniProt 1–103 Author chain Ai； PDBConstruct 1–103； UniProt 1–103

Flagellar biosynthetic protein FlhB

OrganismNot specified

UniProt A0AAE4M6S6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 111	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar M-ring protein × 72 （Q75N27） Flagellar biosynthetic protein FliQ × 4 （A0A0T7EAU9） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar hook-basal body complex protein FliE × 6 （A0A2L2K9J6） Alanine-modelled FlgB-Dc loop × 5 FliE-helix 1 × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0AAE4M6S6_9VIBR
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Aj； PDBConstruct 1–376； UniProt 1–376

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8z5x
Deposition date deposition_date	2024-04-18
Structure title title	Cryo-EM structure of the MS ring with the proximal rod and the export apparatus (C1) within the polar flagellar motor
Keywords keywords	Polar flagellum, Polar flagellar motor, MS ring, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8z5x__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8z5x__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8z5x__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	75.24 Å
Rg (electron density)	74.66 Å
Total Rg	74.71 Å
Atom count	88315
Residues	11398
Excluded volume	1568900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8z5x__assembly_1__model_1`	111-meric （111）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	31314.9 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,9,AP,Ak,Al
Atom count atom_count	88315

MTKGNPIRLLLSTLLLFVGVLFSSFSFAEAEESALPDNLADGSSVTVQAMQSDTGASRAMSVSSGGGIPAFTMTTNPDGSEDYSVTLQILALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIALFLTFFVMSPVLNEINDKAVQPYLNEQVTAREAFDAAQAPMKAFMLKQTRIKDLETFVTMSGEQVDNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGMMMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSFAL

Entity 2 Entity 2 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	63915.6 kDa
Source method src_method	nat
Copy count entity_count	72

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;1,2,3,4,5,A,AA,AB,AC,AD,AE,AF,AG,AH,AI,AJ,AK,AL,AM,AN,AO,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,a,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x,y,z ;

MADKSTDLTVTEGGSDGALVASSDVDVESQNPDLEERSASKFDMAVGDLDLLRQVVLVLSISICVALIVMLFFWVKEPEMRPLGAYETEELIPVLDYLDQQKINYKLDGNTISVESSEYNSIKLGMVRSGVNQATEAGDDILLQDMGFGVSQRLEQERLKLSRERQLAQAIEEMKQVRKARVLLALPKHSVFVRHNQEASASVFLTLSTGTNLKQQEVDSIVDMVASAVPGMKTSRITVTDQHGRLLSSGSQDPASAARRKEQELERSQEQALREKIDSVLLPILGYGNYTAQVDIQMDFSAVEQTRKRFDPNTPATRSEYALEDYNNGNMVAGIPGALSNQPPADASIPQDVAQMKDGSVMGQGSVRKESTRNFELDTTISHERKQTGTVARQTVSVAIKDRRQVNPDTGEVTYTPMSESEINAIRQVLIGTVGFDQGRGDLLNVLSVKFAEPEAEQLEEPPIWEHPNFSDWVRWFASALVIIVVVLVLVRPAMKKLLNPTSDDEDEMYGPDGLPIGADGETSLIGSDIESSELFEFGSSIDLPNLHKDEDVLKAVRALVANEPELAAQVVKNWMNDNG

Entity 3 Entity 3 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	10329.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6,7,AQ,AR

MTPEMFVELFREALWMVLIMVCAIIIPSLLIGLIVAIFQAATSINEQTLSFLPRLIVTLLALMLFGHWMTQMLMEYFYGLIERLPQVLY

Entity 4 Entity 4 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	28905.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MEYPTSVVLDWIANYFWPYVRISSMLMVMTVTGARFVSPRIRLYLGLAITFAVMPAIPAVPQDIELLSFRGFMTIAEQMIIGIAMGMVTQFMIQTFVLLGQILGMQSSLGFASMVDPANGQNTPLLGQLFMFLTTMFFLATDGHLKMLQLVVFSFKTLPIGSGSLNAVDFREMAGWLGIMFQTALSMSLSGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVGLLLCWYILAGLYSHYEMFWTVGEAQICRLIRLEC

Entity 5 Entity 5 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	14240.0 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS,AT,AU,AV,AW

MAISFDNALGIHQHTVGVRERNAEVISTNIAQANTPGYKARGLDFAKELQAATSGASIGLSRTDGRHIPATTTLVGDKLYRLPTQPDTGDGNTVDLDLERNLFMQNQIRHQASLDFLGSKFKNLTKAIKGE

Entity 6 Entity 6 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	14812.6 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AX,AY,AZ,Aa,Ab,Ac

MSLFNVFNVTGSAMSAESVRLNTTSSNLANADSVSSSAKDTYKARHAVFGAELSNAMRGGDTVPVKVMGIVESDKPLSAEYNPDHPLANEEGYIYKPNVNVMEEMANMISASRAYQTNVQVADSSKQMLLRTLQMGQ

Entity 7 Entity 7 polymer

Description description	Flagellar hook-basal body complex protein FliE
Molecular weight formula_weight	11135.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ad,Ae,Af,Ag,Ah,Ai

MKVDGIQAEMRAMMVEATNTAPTASGAKVGADFNDLLTKAINNVNTLQKASGDLQTRFDRGDADVSLSDVMIARNKSSVAFDATVQIRNKLVEAYKDLMNMPV

Entity 8 Entity 8 polymer

Description description	Flagellar biosynthetic protein FlhB
Molecular weight formula_weight	42197.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aj

MAESDGQERTEEATPRRLQQAREKGQVARSKELASASVLIVGAISLMWFGEALARSLFSIMSRLFDLQREEIFDTAKLFDIALGAMTDLLFPLFLVLATLFTAAMIGAAGVGGISFSAQAAMPKLSKMNPLSGLKRMVGMQSWVELIKSILKVVLVTGVAIYLIQASQADLIQLSMDVYPQNIFHALDILLNFILLISCSLLIVVAIDIPFQIWQHADQLKMTKQEVKDEYKETEGKPEVKGRIRMLQREAAQRRMMADVPQADVIVTNPEHFSVALRYKQKTDRAPVVIAKGTDHMAMKIREVAREHDITIVPAPPLARALYHTTELEQEIPDGLFTAVAQVLAFVFQLKQYRKRGGQRPKIQDYDLPIPPEHRH

Entity 9 Entity 9 polymer

Description description	Alanine-modelled FlgB-Dc loop
Molecular weight formula_weight	1395.6 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Am,An,Ao,Ap,Aq

IGLSRTDGRHIPA

Entity 10 Entity 10 polymer

Description description	FliE-helix 1
Molecular weight formula_weight	1867.2 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ar,As,At,Au,Av,Aw

VDGIQAEMRAMMVEATN

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.64 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	58418

Cryo-EM structure of the MS ring with the proximal rod and the export apparatus (C1) within the polar flagellar motor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FlhB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8z5x__assembly_1__model_1

8z5x__assembly_1__model_1 | I(q)

8z5x__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer