9brb

Synaptic Vesicle V-ATPase with synaptophysin and SidK, State 1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

H(+)-transporting two-sector ATPase

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D4A133_RAT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–647； UniProt 1–647 Author chain B； PDBConstruct 1–647； UniProt 1–647 Author chain C； PDBConstruct 1–647； UniProt 1–647

V-type proton ATPase subunit B, brain isoform

OrganismNot specified

UniProt P62815

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATB2_RAT
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–511； UniProt 1–511 Author chain E； PDBConstruct 1–511； UniProt 1–511 Author chain F； PDBConstruct 1–511； UniProt 1–511

V-type proton ATPase subunit C 1

OrganismNot specified

UniProt Q5FVI6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATC1_RAT
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–382； UniProt 1–382

ATPase H+-transporting V1 subunit D

OrganismNot specified

UniProt Q6P503

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6P503_RAT
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–247； UniProt 1–247

V-type proton ATPase subunit E 1

OrganismNot specified

UniProt Q6PCU2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATE1_RAT
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–226； UniProt 1–226 Author chain J； PDBConstruct 1–226； UniProt 1–226 Author chain K； PDBConstruct 1–226； UniProt 1–226

V-type proton ATPase subunit F

OrganismNot specified

UniProt P50408

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATF_RAT
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain L； PDBConstruct 1–119； UniProt 1–119

V-type proton ATPase subunit G

OrganismNot specified

UniProt Q8R2H0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8R2H0_RAT
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain M； PDBConstruct 1–118； UniProt 1–118 Author chain N； PDBConstruct 1–118； UniProt 1–118 Author chain O； PDBConstruct 1–118； UniProt 1–118

V-type proton ATPase subunit S1

OrganismNot specified

UniProt O54715

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VAS1_RAT
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain P； PDBConstruct 1–463； UniProt 1–463

Type IV secretion protein Dot

Legionella pneumophila subsp. pneumophila

UniProt Q5ZWW6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5ZWW6_LEGPH
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain Q； PDBConstruct 1–573； UniProt 1–573 Author chain R； PDBConstruct 1–573； UniProt 1–573 Author chain S； PDBConstruct 1–573； UniProt 1–573

V-type proton ATPase subunit H

OrganismNot specified

UniProt A0A8I5ZQ24

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8I5ZQ24_RAT
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain T； PDBConstruct 1–463； UniProt 1–463

Synaptophysin

OrganismNot specified

UniProt P07825

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SYPH_RAT
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain U； PDBConstruct 1–307； UniProt 1–307

V-type proton ATPase 116 kDa subunit a isoform 1

OrganismNot specified

UniProt P25286

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VPP1_RAT
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain a； PDBConstruct 1–838； UniProt 1–838

ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a

OrganismNot specified

UniProt B0K022

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B0K022_RAT
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain b； PDBConstruct 1–205； UniProt 1–205

V-type proton ATPase subunit

OrganismNot specified

UniProt Q5M7T6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5M7T6_RAT
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain d； PDBConstruct 1–351； UniProt 1–351

V-type proton ATPase subunit e 2

OrganismNot specified

UniProt Q5EB76

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VA0E2_RAT
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain e； PDBConstruct 1–81； UniProt 1–81

Rnasek protein

OrganismNot specified

UniProt A0A8J8YMT9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8J8YMT9_RAT
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain f； PDBConstruct 1–94； UniProt 5–98

V-type proton ATPase 16 kDa proteolipid subunit c

OrganismNot specified

UniProt P63081

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） Renin receptor × 1 （Q6AXS4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATL_RAT
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain g； PDBConstruct 1–155； UniProt 1–155 Author chain h； PDBConstruct 1–155； UniProt 1–155 Author chain i； PDBConstruct 1–155； UniProt 1–155 Author chain j； PDBConstruct 1–155； UniProt 1–155 Author chain k； PDBConstruct 1–155； UniProt 1–155 Author chain l； PDBConstruct 1–155； UniProt 1–155 Author chain m； PDBConstruct 1–155； UniProt 1–155 Author chain n； PDBConstruct 1–155； UniProt 1–155 Author chain o； PDBConstruct 1–155； UniProt 1–155

Renin receptor

OrganismNot specified

UniProt Q6AXS4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	H(+)-transporting two-sector ATPase × 3 （D4A133） V-type proton ATPase subunit B, brain isoform × 3 （P62815） V-type proton ATPase subunit C 1 × 1 （Q5FVI6） ATPase H+-transporting V1 subunit D × 1 （Q6P503） V-type proton ATPase subunit E 1 × 3 （Q6PCU2） V-type proton ATPase subunit F × 1 （P50408） V-type proton ATPase subunit G × 3 （Q8R2H0） V-type proton ATPase subunit S1 × 1 （O54715） Type IV secretion protein Dot × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （A0A8I5ZQ24） Synaptophysin × 1 （P07825） V-type proton ATPase 116 kDa subunit a isoform 1 × 1 （P25286） ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a × 1 （B0K022） V-type proton ATPase subunit × 1 （Q5M7T6） V-type proton ATPase subunit e 2 × 1 （Q5EB76） Rnasek protein × 1 （A0A8J8YMT9） V-type proton ATPase 16 kDa proteolipid subunit c × 9 （P63081）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RENR_RAT
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain p； PDBConstruct 1–350； UniProt 1–350

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9brb
Deposition date deposition_date	2024-05-11
Structure title title	Synaptic Vesicle V-ATPase with synaptophysin and SidK, State 1
Keywords keywords	Vesicle, synaptic, membrane, PROTON TRANSPORT; PROTON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9brb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9brb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9brb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	83.19 Å
Rg (electron density)	83.40 Å
Total Rg	83.35 Å
Atom count	46437
Residues	9423
Excluded volume	747400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9brb__assembly_1__model_1`	36-meric （36）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	H(+)-transporting two-sector ATPase
Molecular weight formula_weight	71483.4 kDa
EC 编号 ec_number	7.1.2.2
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	46437

MCFKFKSDRASGSGLGTDSALRARAGKFSTMDFSKLPKIRDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWEFIPSKNLRVGSHITGGDIYGIVNENSLIKHKIMLPPRSRGSVTYIAPPGNYDASDVVLELEFEGVKEKLSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMISFYDMARRAVETTAQSDNKITWSIIREHMGEILYKLSSMKFKDPVKDGEAKIKADYAQLLEDMQNAFRSLED

Entity 2 Entity 2 polymer

Description description	V-type proton ATPase subunit B, brain isoform
Molecular weight formula_weight	56611.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

MALRAMRGIVNGAAPELPVPTGGPMAGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSNQLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFEKNFITQGPYENRTVYETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH

Entity 3 Entity 3 polymer

Description description	V-type proton ATPase subunit C 1
Molecular weight formula_weight	43958.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFKKAVDDFRHKARENKFIVRDFQYNEEEMRADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK

Entity 4 Entity 4 polymer

Description description	ATPase H+-transporting V1 subunit D
Molecular weight formula_weight	28359.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKIIKEKSEKDLERRRAAGEVMEPANLLAEEKDEDLLFE

Entity 5 Entity 5 polymer

Description description	V-type proton ATPase subunit E 1
Molecular weight formula_weight	26167.5 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K

MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDLEAYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD

Entity 6 Entity 6 polymer

Description description	V-type proton ATPase subunit F
Molecular weight formula_weight	13389.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR

Entity 7 Entity 7 polymer

Description description	V-type proton ATPase subunit G
Molecular weight formula_weight	13690.5 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,O

MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLTQLLGMVCDVRPQVHPNYRITV

Entity 8 Entity 8 polymer

Description description	V-type proton ATPase subunit S1
Molecular weight formula_weight	51160.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MMAATVVSRIRTGTRWAPVLWLLLSLVAVAAAVAAEQQVPLVLWSSDRDLWAPVADTHEGHITSDMQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLHVDLATLKELKLNASLPALLLIRLPYTASSGLMAPREVLTGNDEVIGQVLSTLESEDVPYTAALTAVRPSRVARDVAMVAGGLGRQLLQTQVASPAIHPPVSYNDTAPRILFWAQNFSVAYKDEWKDLTSLTFGVENLNLTGSFWNDSFAMLSLTYEPLFGATVTFKFILASRFYPVSARYWFTMERLEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSLSKKGSLLVTNVPSLWQMTLHNFQIQAFNVTGEQFSYASDCAGFFSPGIWMGLLTTLFMLFIFTYGLHMILSLKTMDRFDDRKGPTITLTQIV

Entity 9 Entity 9 polymer

Description description	Type IV secretion protein Dot
Molecular weight formula_weight	65505.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,R,S

MSFIKVGIKMGGLTSEQYHSQVVGKIGYIARCMQTIDPENNLKKIREDYQDVLIWAEKNYRFEEILEASKSGKCPNDLDALSRRSLILQELLRLVSSISPFKMKLDLIESQYEKMKQHVNLWKSDYHVKLNQLNQLTDYLKNAAPTPKNNFLRAMTSVLQMQIAQYGITEDNEGINQLFKLGLHLLAMANEKIDEQYHLFKGYVKDQPEESPFEGILPAEDQKILVKTMIDYAMPKLSSKVLQDKLSALSSSDVLTKTLLDSIDRIVKENEKLNALSKVKLGKFGLDIREIEVIYSQALKISPQDALQYTAQQCDAQLLSMAFPDSQNYIIESISNKKVKTIAELIHSKEFIYQIIKTEVFKQVDPNEKIRLQAATELYQLLGRIMDKQINLFTKMNLEQINEYIQTKTKAILDKIPERVELLTFMGFEIPTFKGIETLMTDISHSQDNETLAIAQEFYTNIKNAKNQLLGDKLIEDITPQDVEKFFNQCSQYGSEAAEKLADNRPVLTKIADILTAIARWAISLIGFNTPPQFLAPTRTCVDQVSDEITKIKLKLEDTLGSLQKVQEESLSL

Source Source

Source organism organism	Legionella pneumophila subsp. pneumophila
NCBI taxonomy ID ncbi_taxonomy_id	91891
Host organism host_organism	Escherichia coli

Entity 10 Entity 10 polymer

Description description	V-type proton ATPase subunit H
Molecular weight formula_weight	53661.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRCSEEKQEMLQTEGSQCAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKSTAWPYFLPMLNRQDPFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQKLRGSGVAVETGTISASDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCGFQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHN

Entity 11 Entity 11 polymer

Description description	Synaptophysin
Molecular weight formula_weight	33331.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGYGPQGDYGQQGYGQQGAPTSFSNQM

Entity 12 Entity 12 polymer

Description description	V-type proton ATPase 116 kDa subunit a isoform 1
Molecular weight formula_weight	96429.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MGELFRSEEMTLAQLFLQSEAAYCCVSELEELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPNEMGRGAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQTPPTYNKTNKFTHGFQNIVDAYGIGTYREINPAPYTVITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSMVFSGRYIILLMGLFSIYTGLIYNDCFSKSLNIFGSSWSVRPMFTIGNWTEETLLGSSVLQLNPAIPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFYKWTAYDAHSSRNAPSLLIHFINMFLFSYPESGNAMLYSGQKGIQCFLIVVAMLCVPWMLLFKPLILRHQYLRKKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLHVRSLAGGLGLFFIFAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSFEHIREGKFDE

Entity 13 Entity 13 polymer

Description description	ATPase, H+ transporting, V0 subunit B (Predicted), isoform CRA_a
Molecular weight formula_weight	21618.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MTGLELLYLGIFVAFWACMIVVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD

Entity 14 Entity 14 polymer

Description description	V-type proton ATPase subunit
Molecular weight formula_weight	40341.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF

Entity 15 Entity 15 polymer

Description description	V-type proton ATPase subunit e 2
Molecular weight formula_weight	9203.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETIWYVRFLWE

Entity 16 Entity 16 polymer

Description description	Rnasek protein
Molecular weight formula_weight	10597.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

LCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR

Entity 17 Entity 17 polymer

Description description	V-type proton ATPase 16 kDa proteolipid subunit c
Molecular weight formula_weight	15815.8 kDa
Source method src_method	nat
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h,i,j,k,l,m,n,o

MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK

Entity 18 Entity 18 polymer

Description description	Renin receptor
Molecular weight formula_weight	39118.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MAVLVVLLSSLVSSALANEFSILRSPGSVVFRNGNWPIPGDRIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATIMVTVKGVDKLALPTGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLNSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDELGKRYGEDSEQFRDASRILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLVRKSRTILETKQENTQSPYNLAYKYNLEYSVVFNLVLWIMTGLALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	123220

Synaptic Vesicle V-ATPase with synaptophysin and SidK, State 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

H(+)-transporting two-sector ATPase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit B, brain isoform

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit C 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATPase H+-transporting V1 subunit D

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit E 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit G

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit S1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type IV secretion protein Dot

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer