9c97

Yeast 20S proteasome soaked with BRA-346 fraction

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PRE8 isoform 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	PRE9 isoform 1 × 2 （A0A6A5PXC6） PRE6 isoform 1 × 2 （A0A6A5Q273） PUP2 isoform 1 × 2 （A0A6A5PXN2） PRE5 isoform 1 × 2 （A0A6A5PTH4） PRE10 isoform 1 × 2 （A0A6A5Q4M4） SCL1 isoform 1 × 2 （A0A6A5PYC9） proteasome endopeptidase complex × 2 （A0A6A5Q449） PUP3 isoform 1 × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） proteasome endopeptidase complex × 2 （A0A6A5Q5W3） PRE7 isoform 1 × 2 （A0A6A5Q0P3） Proteasome subunit beta × 2 （A0A8H8ULD3） Proteasome subunit beta type-1 × 2 （P38624） SULFATE ION × 44 MAGNESIUM ION × 9 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L1BIF8_YEASX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–250； UniProt 1–250 Author chain O； PDBConstruct 1–250； UniProt 1–250

PRE9 isoform 1

OrganismNot specified

UniProt A0A6A5PXC6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	PRE8 isoform 1 × 2 （A0A6L1BIF8） PRE6 isoform 1 × 2 （A0A6A5Q273） PUP2 isoform 1 × 2 （A0A6A5PXN2） PRE5 isoform 1 × 2 （A0A6A5PTH4） PRE10 isoform 1 × 2 （A0A6A5Q4M4） SCL1 isoform 1 × 2 （A0A6A5PYC9） proteasome endopeptidase complex × 2 （A0A6A5Q449） PUP3 isoform 1 × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） proteasome endopeptidase complex × 2 （A0A6A5Q5W3） PRE7 isoform 1 × 2 （A0A6A5Q0P3） Proteasome subunit beta × 2 （A0A8H8ULD3） Proteasome subunit beta type-1 × 2 （P38624） SULFATE ION × 44 MAGNESIUM ION × 9 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PXC6_YEASX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–258； UniProt 1–258 Author chain P； PDBConstruct 1–258； UniProt 1–258

PRE6 isoform 1

OrganismNot specified

UniProt A0A6A5Q273

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	PRE8 isoform 1 × 2 （A0A6L1BIF8） PRE9 isoform 1 × 2 （A0A6A5PXC6） PUP2 isoform 1 × 2 （A0A6A5PXN2） PRE5 isoform 1 × 2 （A0A6A5PTH4） PRE10 isoform 1 × 2 （A0A6A5Q4M4） SCL1 isoform 1 × 2 （A0A6A5PYC9） proteasome endopeptidase complex × 2 （A0A6A5Q449） PUP3 isoform 1 × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） proteasome endopeptidase complex × 2 （A0A6A5Q5W3） PRE7 isoform 1 × 2 （A0A6A5Q0P3） Proteasome subunit beta × 2 （A0A8H8ULD3） Proteasome subunit beta type-1 × 2 （P38624） SULFATE ION × 44 MAGNESIUM ION × 9 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q273_YEASX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–254； UniProt 1–254 Author chain Q； PDBConstruct 1–254； UniProt 1–254

PUP2 isoform 1

OrganismNot specified

UniProt A0A6A5PXN2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	PRE8 isoform 1 × 2 （A0A6L1BIF8） PRE9 isoform 1 × 2 （A0A6A5PXC6） PRE6 isoform 1 × 2 （A0A6A5Q273） PRE5 isoform 1 × 2 （A0A6A5PTH4） PRE10 isoform 1 × 2 （A0A6A5Q4M4） SCL1 isoform 1 × 2 （A0A6A5PYC9） proteasome endopeptidase complex × 2 （A0A6A5Q449） PUP3 isoform 1 × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） proteasome endopeptidase complex × 2 （A0A6A5Q5W3） PRE7 isoform 1 × 2 （A0A6A5Q0P3） Proteasome subunit beta × 2 （A0A8H8ULD3） Proteasome subunit beta type-1 × 2 （P38624） SULFATE ION × 44 MAGNESIUM ION × 9 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PXN2_YEASX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–260； UniProt 1–260 Author chain R； PDBConstruct 1–260； UniProt 1–260

PRE5 isoform 1

OrganismNot specified

UniProt A0A6A5PTH4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	PRE8 isoform 1 × 2 （A0A6L1BIF8） PRE9 isoform 1 × 2 （A0A6A5PXC6） PRE6 isoform 1 × 2 （A0A6A5Q273） PUP2 isoform 1 × 2 （A0A6A5PXN2） PRE10 isoform 1 × 2 （A0A6A5Q4M4） SCL1 isoform 1 × 2 （A0A6A5PYC9） proteasome endopeptidase complex × 2 （A0A6A5Q449） PUP3 isoform 1 × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） proteasome endopeptidase complex × 2 （A0A6A5Q5W3） PRE7 isoform 1 × 2 （A0A6A5Q0P3） Proteasome subunit beta × 2 （A0A8H8ULD3） Proteasome subunit beta type-1 × 2 （P38624） SULFATE ION × 44 MAGNESIUM ION × 9 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PTH4_YEASX
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–234； UniProt 1–234 Author chain S； PDBConstruct 1–234； UniProt 1–234

PRE10 isoform 1

OrganismNot specified

UniProt A0A6A5Q4M4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	PRE8 isoform 1 × 2 （A0A6L1BIF8） PRE9 isoform 1 × 2 （A0A6A5PXC6） PRE6 isoform 1 × 2 （A0A6A5Q273） PUP2 isoform 1 × 2 （A0A6A5PXN2） PRE5 isoform 1 × 2 （A0A6A5PTH4） SCL1 isoform 1 × 2 （A0A6A5PYC9） proteasome endopeptidase complex × 2 （A0A6A5Q449） PUP3 isoform 1 × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） proteasome endopeptidase complex × 2 （A0A6A5Q5W3） PRE7 isoform 1 × 2 （A0A6A5Q0P3） Proteasome subunit beta × 2 （A0A8H8ULD3） Proteasome subunit beta type-1 × 2 （P38624） SULFATE ION × 44 MAGNESIUM ION × 9 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q4M4_YEASX
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–287； UniProt 2–288 Author chain T； PDBConstruct 1–287； UniProt 2–288

SCL1 isoform 1

OrganismNot specified

UniProt A0A6A5PYC9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	PRE8 isoform 1 × 2 （A0A6L1BIF8） PRE9 isoform 1 × 2 （A0A6A5PXC6） PRE6 isoform 1 × 2 （A0A6A5Q273） PUP2 isoform 1 × 2 （A0A6A5PXN2） PRE5 isoform 1 × 2 （A0A6A5PTH4） PRE10 isoform 1 × 2 （A0A6A5Q4M4） proteasome endopeptidase complex × 2 （A0A6A5Q449） PUP3 isoform 1 × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） proteasome endopeptidase complex × 2 （A0A6A5Q5W3） PRE7 isoform 1 × 2 （A0A6A5Q0P3） Proteasome subunit beta × 2 （A0A8H8ULD3） Proteasome subunit beta type-1 × 2 （P38624） SULFATE ION × 44 MAGNESIUM ION × 9 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PYC9_YEASX
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–252； UniProt 1–252 Author chain U； PDBConstruct 1–252； UniProt 1–252

proteasome endopeptidase complex

OrganismNot specified

UniProt A0A6A5Q449

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	PRE8 isoform 1 × 2 （A0A6L1BIF8） PRE9 isoform 1 × 2 （A0A6A5PXC6） PRE6 isoform 1 × 2 （A0A6A5Q273） PUP2 isoform 1 × 2 （A0A6A5PXN2） PRE5 isoform 1 × 2 （A0A6A5PTH4） PRE10 isoform 1 × 2 （A0A6A5Q4M4） SCL1 isoform 1 × 2 （A0A6A5PYC9） PUP3 isoform 1 × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） proteasome endopeptidase complex × 2 （A0A6A5Q5W3） PRE7 isoform 1 × 2 （A0A6A5Q0P3） Proteasome subunit beta × 2 （A0A8H8ULD3） Proteasome subunit beta type-1 × 2 （P38624） SULFATE ION × 44 MAGNESIUM ION × 9 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q449_YEASX
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–232； UniProt 30–261 Author chain V； PDBConstruct 1–232； UniProt 30–261

PUP3 isoform 1

OrganismNot specified

UniProt A0A6L0YA22

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	PRE8 isoform 1 × 2 （A0A6L1BIF8） PRE9 isoform 1 × 2 （A0A6A5PXC6） PRE6 isoform 1 × 2 （A0A6A5Q273） PUP2 isoform 1 × 2 （A0A6A5PXN2） PRE5 isoform 1 × 2 （A0A6A5PTH4） PRE10 isoform 1 × 2 （A0A6A5Q4M4） SCL1 isoform 1 × 2 （A0A6A5PYC9） proteasome endopeptidase complex × 2 （A0A6A5Q449） Proteasome subunit beta × 2 （A0A6A5Q0W2） proteasome endopeptidase complex × 2 （A0A6A5Q5W3） PRE7 isoform 1 × 2 （A0A6A5Q0P3） Proteasome subunit beta × 2 （A0A8H8ULD3） Proteasome subunit beta type-1 × 2 （P38624） SULFATE ION × 44 MAGNESIUM ION × 9 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L0YA22_YEASX
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–205； UniProt 1–205 Author chain W； PDBConstruct 1–205； UniProt 1–205

Proteasome subunit beta

OrganismNot specified

UniProt A0A6A5Q0W2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	PRE8 isoform 1 × 2 （A0A6L1BIF8） PRE9 isoform 1 × 2 （A0A6A5PXC6） PRE6 isoform 1 × 2 （A0A6A5Q273） PUP2 isoform 1 × 2 （A0A6A5PXN2） PRE5 isoform 1 × 2 （A0A6A5PTH4） PRE10 isoform 1 × 2 （A0A6A5Q4M4） SCL1 isoform 1 × 2 （A0A6A5PYC9） proteasome endopeptidase complex × 2 （A0A6A5Q449） PUP3 isoform 1 × 2 （A0A6L0YA22） proteasome endopeptidase complex × 2 （A0A6A5Q5W3） PRE7 isoform 1 × 2 （A0A6A5Q0P3） Proteasome subunit beta × 2 （A0A8H8ULD3） Proteasome subunit beta type-1 × 2 （P38624） SULFATE ION × 44 MAGNESIUM ION × 9 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q0W2_YEASX
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–198； UniProt 1–198 Author chain X； PDBConstruct 1–198； UniProt 1–198

proteasome endopeptidase complex

OrganismNot specified

UniProt A0A6A5Q5W3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	PRE8 isoform 1 × 2 （A0A6L1BIF8） PRE9 isoform 1 × 2 （A0A6A5PXC6） PRE6 isoform 1 × 2 （A0A6A5Q273） PUP2 isoform 1 × 2 （A0A6A5PXN2） PRE5 isoform 1 × 2 （A0A6A5PTH4） PRE10 isoform 1 × 2 （A0A6A5Q4M4） SCL1 isoform 1 × 2 （A0A6A5PYC9） proteasome endopeptidase complex × 2 （A0A6A5Q449） PUP3 isoform 1 × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） PRE7 isoform 1 × 2 （A0A6A5Q0P3） Proteasome subunit beta × 2 （A0A8H8ULD3） Proteasome subunit beta type-1 × 2 （P38624） SULFATE ION × 44 MAGNESIUM ION × 9 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q5W3_YEASX
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–212； UniProt 76–287 Author chain Y； PDBConstruct 1–212； UniProt 76–287

PRE7 isoform 1

OrganismNot specified

UniProt A0A6A5Q0P3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	PRE8 isoform 1 × 2 （A0A6L1BIF8） PRE9 isoform 1 × 2 （A0A6A5PXC6） PRE6 isoform 1 × 2 （A0A6A5Q273） PUP2 isoform 1 × 2 （A0A6A5PXN2） PRE5 isoform 1 × 2 （A0A6A5PTH4） PRE10 isoform 1 × 2 （A0A6A5Q4M4） SCL1 isoform 1 × 2 （A0A6A5PYC9） proteasome endopeptidase complex × 2 （A0A6A5Q449） PUP3 isoform 1 × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） proteasome endopeptidase complex × 2 （A0A6A5Q5W3） Proteasome subunit beta × 2 （A0A8H8ULD3） Proteasome subunit beta type-1 × 2 （P38624） SULFATE ION × 44 MAGNESIUM ION × 9 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q0P3_YEASX
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–222； UniProt 20–241 Author chain Z； PDBConstruct 1–222； UniProt 20–241

Proteasome subunit beta

OrganismNot specified

UniProt A0A8H8ULD3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	PRE8 isoform 1 × 2 （A0A6L1BIF8） PRE9 isoform 1 × 2 （A0A6A5PXC6） PRE6 isoform 1 × 2 （A0A6A5Q273） PUP2 isoform 1 × 2 （A0A6A5PXN2） PRE5 isoform 1 × 2 （A0A6A5PTH4） PRE10 isoform 1 × 2 （A0A6A5Q4M4） SCL1 isoform 1 × 2 （A0A6A5PYC9） proteasome endopeptidase complex × 2 （A0A6A5Q449） PUP3 isoform 1 × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） proteasome endopeptidase complex × 2 （A0A6A5Q5W3） PRE7 isoform 1 × 2 （A0A6A5Q0P3） Proteasome subunit beta type-1 × 2 （P38624） SULFATE ION × 44 MAGNESIUM ION × 9 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8H8ULD3_YEASX
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–233； UniProt 34–266 Author chain a； PDBConstruct 1–233； UniProt 34–266

Proteasome subunit beta type-1

OrganismNot specified

UniProt P38624

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	PRE8 isoform 1 × 2 （A0A6L1BIF8） PRE9 isoform 1 × 2 （A0A6A5PXC6） PRE6 isoform 1 × 2 （A0A6A5Q273） PUP2 isoform 1 × 2 （A0A6A5PXN2） PRE5 isoform 1 × 2 （A0A6A5PTH4） PRE10 isoform 1 × 2 （A0A6A5Q4M4） SCL1 isoform 1 × 2 （A0A6A5PYC9） proteasome endopeptidase complex × 2 （A0A6A5Q449） PUP3 isoform 1 × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） proteasome endopeptidase complex × 2 （A0A6A5Q5W3） PRE7 isoform 1 × 2 （A0A6A5Q0P3） Proteasome subunit beta × 2 （A0A8H8ULD3） SULFATE ION × 44 MAGNESIUM ION × 9 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB1_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain N； PDBConstruct 1–196； UniProt 20–215 Author chain b； PDBConstruct 1–196； UniProt 20–215

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9c97
Deposition date deposition_date	2024-06-13
Structure title title	Yeast 20S proteasome soaked with BRA-346 fraction
Keywords keywords	hydrolase; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9c97__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9c97__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9c97__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	59.84 Å
Rg (electron density)	59.54 Å
Total Rg	59.69 Å
Atom count	49550
Residues	6338
Excluded volume	880720 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9c97__assembly_1__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	PRE8 isoform 1
Molecular weight formula_weight	27191.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,O
Atom count atom_count	49866

MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL

Entity 2 Entity 2 polymer

Description description	PRE9 isoform 1
Molecular weight formula_weight	28748.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,P

MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGITKKDEDEEADEDMK

Entity 3 Entity 3 polymer

Description description	PRE6 isoform 1
Molecular weight formula_weight	28478.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,Q

MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQQEQDKKKKSNH

Entity 4 Entity 4 polymer

Description description	PUP2 isoform 1
Molecular weight formula_weight	28649.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,R

MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAESPEEADVEMS

Entity 5 Entity 5 polymer

Description description	PRE5 isoform 1
Molecular weight formula_weight	25634.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,S

MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI

Entity 6 Entity 6 polymer

Description description	PRE10 isoform 1
Molecular weight formula_weight	31443.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,T

TSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEINGDDDEDEDDSDNVMSSDDENAPVATNANATTDQEGDIHLE

Entity 7 Entity 7 polymer

Description description	SCL1 isoform 1
Molecular weight formula_weight	28033.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,U

MSGAAAASAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD

Entity 8 Entity 8 polymer

Description description	proteasome endopeptidase complex
Molecular weight formula_weight	25114.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,V

TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICDIQEEQVDITA

Entity 9 Entity 9 polymer

Description description	PUP3 isoform 1
Molecular weight formula_weight	22627.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,W

MSDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD

Entity 10 Entity 10 polymer

Description description	Proteasome subunit beta
Molecular weight formula_weight	22545.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,X

MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ

Entity 11 Entity 11 polymer

Description description	proteasome endopeptidase complex
Molecular weight formula_weight	23325.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,Y

TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG

Entity 12 Entity 12 polymer

Description description	PRE7 isoform 1
Molecular weight formula_weight	24883.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,Z

QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD

Entity 13 Entity 13 polymer

Description description	Proteasome subunit beta
Molecular weight formula_weight	25945.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,a

TQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPLADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI

Entity 14 Entity 14 polymer

Description description	Proteasome subunit beta type-1
Molecular weight formula_weight	21517.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,b

TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL

Entity 15 Entity 15 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	44

Entity 16 Entity 16 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 17 Entity 17 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	316

▶

Unit-cell length a length_a	117.511 Å
Unit-cell length b length_b	299.917 Å
Unit-cell length c length_c	143.913 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	108.46 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	3.330 Å
Low-resolution limit resolution_low	49.110 Å
R factor r_factor	0.2028
R_work r_work	0.2001
R_free r_free	0.2520

Yeast 20S proteasome soaked with BRA-346 fraction

1. Protein Identity and Related Structures Protein Identity & Related Structures

PRE8 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PRE9 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PRE6 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PUP2 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PRE5 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PRE10 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SCL1 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

proteasome endopeptidase complex

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PUP3 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer