7o2l

Yeast 20S proteasome in complex with the covalently bound inhibitor b-lactone (2R,3S)-3-isopropyl-4-oxo-2-oxetane-carboxylate (IOC)

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HLJ1_G0039880.mRNA.1.CDS.1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	BJ4_G0021480.mRNA.1.CDS.1 × 2 （A0A6A5PXC6） HLJ1_G0048980.mRNA.1.CDS.1 × 2 （A0A6A5Q273） 20S proteasome × 2 （P32379） BJ4_G0043800.mRNA.1.CDS.1 × 2 （A0A6A5PTH4） Probable proteasome subunit alpha type-7 × 2 （A0A6A5Q4M4） BJ4_G0020160.mRNA.1.CDS.1 × 2 （A0A6A5PYC9） Proteasome endopeptidase complex × 2 （A0A6A5Q449） Proteasome endopeptidase complex × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） Proteasome subunit beta type-5 × 2 （A0A6V8RU78） Proteasome endopeptidase complex × 2 （A0A6A5Q0P3） Proteasome subunit beta type-7 × 2 （P30657） Proteasome endopeptidase complex × 2 （A0A6L0ZSP2） MAGNESIUM ION × 8 CHLORIDE ION × 2 (2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid × 6 water × 27	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L1BIF8_YEASX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–250； UniProt 1–250 Author chain O； PDBConstruct 1–250； UniProt 1–250

BJ4_G0021480.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A6A5PXC6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	HLJ1_G0039880.mRNA.1.CDS.1 × 2 （A0A6L1BIF8） HLJ1_G0048980.mRNA.1.CDS.1 × 2 （A0A6A5Q273） 20S proteasome × 2 （P32379） BJ4_G0043800.mRNA.1.CDS.1 × 2 （A0A6A5PTH4） Probable proteasome subunit alpha type-7 × 2 （A0A6A5Q4M4） BJ4_G0020160.mRNA.1.CDS.1 × 2 （A0A6A5PYC9） Proteasome endopeptidase complex × 2 （A0A6A5Q449） Proteasome endopeptidase complex × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） Proteasome subunit beta type-5 × 2 （A0A6V8RU78） Proteasome endopeptidase complex × 2 （A0A6A5Q0P3） Proteasome subunit beta type-7 × 2 （P30657） Proteasome endopeptidase complex × 2 （A0A6L0ZSP2） MAGNESIUM ION × 8 CHLORIDE ION × 2 (2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid × 6 water × 27	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PXC6_YEASX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–258； UniProt 1–258 Author chain P； PDBConstruct 1–258； UniProt 1–258

HLJ1_G0048980.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A6A5Q273

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	HLJ1_G0039880.mRNA.1.CDS.1 × 2 （A0A6L1BIF8） BJ4_G0021480.mRNA.1.CDS.1 × 2 （A0A6A5PXC6） 20S proteasome × 2 （P32379） BJ4_G0043800.mRNA.1.CDS.1 × 2 （A0A6A5PTH4） Probable proteasome subunit alpha type-7 × 2 （A0A6A5Q4M4） BJ4_G0020160.mRNA.1.CDS.1 × 2 （A0A6A5PYC9） Proteasome endopeptidase complex × 2 （A0A6A5Q449） Proteasome endopeptidase complex × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） Proteasome subunit beta type-5 × 2 （A0A6V8RU78） Proteasome endopeptidase complex × 2 （A0A6A5Q0P3） Proteasome subunit beta type-7 × 2 （P30657） Proteasome endopeptidase complex × 2 （A0A6L0ZSP2） MAGNESIUM ION × 8 CHLORIDE ION × 2 (2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid × 6 water × 27	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q273_YEASX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–254； UniProt 1–254 Author chain Q； PDBConstruct 1–254； UniProt 1–254

20S proteasome

OrganismNot specified

UniProt P32379

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	HLJ1_G0039880.mRNA.1.CDS.1 × 2 （A0A6L1BIF8） BJ4_G0021480.mRNA.1.CDS.1 × 2 （A0A6A5PXC6） HLJ1_G0048980.mRNA.1.CDS.1 × 2 （A0A6A5Q273） BJ4_G0043800.mRNA.1.CDS.1 × 2 （A0A6A5PTH4） Probable proteasome subunit alpha type-7 × 2 （A0A6A5Q4M4） BJ4_G0020160.mRNA.1.CDS.1 × 2 （A0A6A5PYC9） Proteasome endopeptidase complex × 2 （A0A6A5Q449） Proteasome endopeptidase complex × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） Proteasome subunit beta type-5 × 2 （A0A6V8RU78） Proteasome endopeptidase complex × 2 （A0A6A5Q0P3） Proteasome subunit beta type-7 × 2 （P30657） Proteasome endopeptidase complex × 2 （A0A6L0ZSP2） MAGNESIUM ION × 8 CHLORIDE ION × 2 (2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid × 6 water × 27	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–260； UniProt 1–260 Author chain R； PDBConstruct 1–260； UniProt 1–260

BJ4_G0043800.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A6A5PTH4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	HLJ1_G0039880.mRNA.1.CDS.1 × 2 （A0A6L1BIF8） BJ4_G0021480.mRNA.1.CDS.1 × 2 （A0A6A5PXC6） HLJ1_G0048980.mRNA.1.CDS.1 × 2 （A0A6A5Q273） 20S proteasome × 2 （P32379） Probable proteasome subunit alpha type-7 × 2 （A0A6A5Q4M4） BJ4_G0020160.mRNA.1.CDS.1 × 2 （A0A6A5PYC9） Proteasome endopeptidase complex × 2 （A0A6A5Q449） Proteasome endopeptidase complex × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） Proteasome subunit beta type-5 × 2 （A0A6V8RU78） Proteasome endopeptidase complex × 2 （A0A6A5Q0P3） Proteasome subunit beta type-7 × 2 （P30657） Proteasome endopeptidase complex × 2 （A0A6L0ZSP2） MAGNESIUM ION × 8 CHLORIDE ION × 2 (2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid × 6 water × 27	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PTH4_YEASX
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–234； UniProt 1–234 Author chain S； PDBConstruct 1–234； UniProt 1–234

Probable proteasome subunit alpha type-7

OrganismNot specified

UniProt A0A6A5Q4M4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	HLJ1_G0039880.mRNA.1.CDS.1 × 2 （A0A6L1BIF8） BJ4_G0021480.mRNA.1.CDS.1 × 2 （A0A6A5PXC6） HLJ1_G0048980.mRNA.1.CDS.1 × 2 （A0A6A5Q273） 20S proteasome × 2 （P32379） BJ4_G0043800.mRNA.1.CDS.1 × 2 （A0A6A5PTH4） BJ4_G0020160.mRNA.1.CDS.1 × 2 （A0A6A5PYC9） Proteasome endopeptidase complex × 2 （A0A6A5Q449） Proteasome endopeptidase complex × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） Proteasome subunit beta type-5 × 2 （A0A6V8RU78） Proteasome endopeptidase complex × 2 （A0A6A5Q0P3） Proteasome subunit beta type-7 × 2 （P30657） Proteasome endopeptidase complex × 2 （A0A6L0ZSP2） MAGNESIUM ION × 8 CHLORIDE ION × 2 (2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid × 6 water × 27	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q4M4_YEASX
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–288； UniProt 1–288 Author chain T； PDBConstruct 1–288； UniProt 1–288

BJ4_G0020160.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A6A5PYC9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	HLJ1_G0039880.mRNA.1.CDS.1 × 2 （A0A6L1BIF8） BJ4_G0021480.mRNA.1.CDS.1 × 2 （A0A6A5PXC6） HLJ1_G0048980.mRNA.1.CDS.1 × 2 （A0A6A5Q273） 20S proteasome × 2 （P32379） BJ4_G0043800.mRNA.1.CDS.1 × 2 （A0A6A5PTH4） Probable proteasome subunit alpha type-7 × 2 （A0A6A5Q4M4） Proteasome endopeptidase complex × 2 （A0A6A5Q449） Proteasome endopeptidase complex × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） Proteasome subunit beta type-5 × 2 （A0A6V8RU78） Proteasome endopeptidase complex × 2 （A0A6A5Q0P3） Proteasome subunit beta type-7 × 2 （P30657） Proteasome endopeptidase complex × 2 （A0A6L0ZSP2） MAGNESIUM ION × 8 CHLORIDE ION × 2 (2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid × 6 water × 27	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PYC9_YEASX
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–252； UniProt 1–252 Author chain U； PDBConstruct 1–252； UniProt 1–252

Proteasome endopeptidase complex

OrganismNot specified

UniProt A0A6A5Q449

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	HLJ1_G0039880.mRNA.1.CDS.1 × 2 （A0A6L1BIF8） BJ4_G0021480.mRNA.1.CDS.1 × 2 （A0A6A5PXC6） HLJ1_G0048980.mRNA.1.CDS.1 × 2 （A0A6A5Q273） 20S proteasome × 2 （P32379） BJ4_G0043800.mRNA.1.CDS.1 × 2 （A0A6A5PTH4） Probable proteasome subunit alpha type-7 × 2 （A0A6A5Q4M4） BJ4_G0020160.mRNA.1.CDS.1 × 2 （A0A6A5PYC9） Proteasome endopeptidase complex × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） Proteasome subunit beta type-5 × 2 （A0A6V8RU78） Proteasome endopeptidase complex × 2 （A0A6A5Q0P3） Proteasome subunit beta type-7 × 2 （P30657） Proteasome endopeptidase complex × 2 （A0A6L0ZSP2） MAGNESIUM ION × 8 CHLORIDE ION × 2 (2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid × 6 water × 27	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q449_YEASX
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–232； UniProt 30–261 Author chain V； PDBConstruct 1–232； UniProt 30–261

Proteasome endopeptidase complex

OrganismNot specified

UniProt A0A6L0YA22

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	HLJ1_G0039880.mRNA.1.CDS.1 × 2 （A0A6L1BIF8） BJ4_G0021480.mRNA.1.CDS.1 × 2 （A0A6A5PXC6） HLJ1_G0048980.mRNA.1.CDS.1 × 2 （A0A6A5Q273） 20S proteasome × 2 （P32379） BJ4_G0043800.mRNA.1.CDS.1 × 2 （A0A6A5PTH4） Probable proteasome subunit alpha type-7 × 2 （A0A6A5Q4M4） BJ4_G0020160.mRNA.1.CDS.1 × 2 （A0A6A5PYC9） Proteasome endopeptidase complex × 2 （A0A6A5Q449） Proteasome subunit beta × 2 （A0A6A5Q0W2） Proteasome subunit beta type-5 × 2 （A0A6V8RU78） Proteasome endopeptidase complex × 2 （A0A6A5Q0P3） Proteasome subunit beta type-7 × 2 （P30657） Proteasome endopeptidase complex × 2 （A0A6L0ZSP2） MAGNESIUM ION × 8 CHLORIDE ION × 2 (2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid × 6 water × 27	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L0YA22_YEASX
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–205； UniProt 1–205 Author chain W； PDBConstruct 1–205； UniProt 1–205

Proteasome subunit beta

OrganismNot specified

UniProt A0A6A5Q0W2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	HLJ1_G0039880.mRNA.1.CDS.1 × 2 （A0A6L1BIF8） BJ4_G0021480.mRNA.1.CDS.1 × 2 （A0A6A5PXC6） HLJ1_G0048980.mRNA.1.CDS.1 × 2 （A0A6A5Q273） 20S proteasome × 2 （P32379） BJ4_G0043800.mRNA.1.CDS.1 × 2 （A0A6A5PTH4） Probable proteasome subunit alpha type-7 × 2 （A0A6A5Q4M4） BJ4_G0020160.mRNA.1.CDS.1 × 2 （A0A6A5PYC9） Proteasome endopeptidase complex × 2 （A0A6A5Q449） Proteasome endopeptidase complex × 2 （A0A6L0YA22） Proteasome subunit beta type-5 × 2 （A0A6V8RU78） Proteasome endopeptidase complex × 2 （A0A6A5Q0P3） Proteasome subunit beta type-7 × 2 （P30657） Proteasome endopeptidase complex × 2 （A0A6L0ZSP2） MAGNESIUM ION × 8 CHLORIDE ION × 2 (2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid × 6 water × 27	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q0W2_YEASX
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–198； UniProt 1–198 Author chain X； PDBConstruct 1–198； UniProt 1–198

Proteasome subunit beta type-5

OrganismNot specified

UniProt A0A6V8RU78

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	HLJ1_G0039880.mRNA.1.CDS.1 × 2 （A0A6L1BIF8） BJ4_G0021480.mRNA.1.CDS.1 × 2 （A0A6A5PXC6） HLJ1_G0048980.mRNA.1.CDS.1 × 2 （A0A6A5Q273） 20S proteasome × 2 （P32379） BJ4_G0043800.mRNA.1.CDS.1 × 2 （A0A6A5PTH4） Probable proteasome subunit alpha type-7 × 2 （A0A6A5Q4M4） BJ4_G0020160.mRNA.1.CDS.1 × 2 （A0A6A5PYC9） Proteasome endopeptidase complex × 2 （A0A6A5Q449） Proteasome endopeptidase complex × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） Proteasome endopeptidase complex × 2 （A0A6A5Q0P3） Proteasome subunit beta type-7 × 2 （P30657） Proteasome endopeptidase complex × 2 （A0A6L0ZSP2） MAGNESIUM ION × 8 CHLORIDE ION × 2 (2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid × 6 water × 27	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6V8RU78_YEASX
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–212； UniProt 76–287 Author chain Y； PDBConstruct 1–212； UniProt 76–287

Proteasome endopeptidase complex

OrganismNot specified

UniProt A0A6A5Q0P3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	HLJ1_G0039880.mRNA.1.CDS.1 × 2 （A0A6L1BIF8） BJ4_G0021480.mRNA.1.CDS.1 × 2 （A0A6A5PXC6） HLJ1_G0048980.mRNA.1.CDS.1 × 2 （A0A6A5Q273） 20S proteasome × 2 （P32379） BJ4_G0043800.mRNA.1.CDS.1 × 2 （A0A6A5PTH4） Probable proteasome subunit alpha type-7 × 2 （A0A6A5Q4M4） BJ4_G0020160.mRNA.1.CDS.1 × 2 （A0A6A5PYC9） Proteasome endopeptidase complex × 2 （A0A6A5Q449） Proteasome endopeptidase complex × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） Proteasome subunit beta type-5 × 2 （A0A6V8RU78） Proteasome subunit beta type-7 × 2 （P30657） Proteasome endopeptidase complex × 2 （A0A6L0ZSP2） MAGNESIUM ION × 8 CHLORIDE ION × 2 (2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid × 6 water × 27	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q0P3_YEASX
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–222； UniProt 20–241 Author chain Z； PDBConstruct 1–222； UniProt 20–241

Proteasome subunit beta type-7

OrganismNot specified

UniProt P30657

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	HLJ1_G0039880.mRNA.1.CDS.1 × 2 （A0A6L1BIF8） BJ4_G0021480.mRNA.1.CDS.1 × 2 （A0A6A5PXC6） HLJ1_G0048980.mRNA.1.CDS.1 × 2 （A0A6A5Q273） 20S proteasome × 2 （P32379） BJ4_G0043800.mRNA.1.CDS.1 × 2 （A0A6A5PTH4） Probable proteasome subunit alpha type-7 × 2 （A0A6A5Q4M4） BJ4_G0020160.mRNA.1.CDS.1 × 2 （A0A6A5PYC9） Proteasome endopeptidase complex × 2 （A0A6A5Q449） Proteasome endopeptidase complex × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） Proteasome subunit beta type-5 × 2 （A0A6V8RU78） Proteasome endopeptidase complex × 2 （A0A6A5Q0P3） Proteasome endopeptidase complex × 2 （A0A6L0ZSP2） MAGNESIUM ION × 8 CHLORIDE ION × 2 (2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid × 6 water × 27	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB7_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–246； UniProt 21–266 Author chain a； PDBConstruct 1–246； UniProt 21–266

Proteasome endopeptidase complex

OrganismNot specified

UniProt A0A6L0ZSP2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	HLJ1_G0039880.mRNA.1.CDS.1 × 2 （A0A6L1BIF8） BJ4_G0021480.mRNA.1.CDS.1 × 2 （A0A6A5PXC6） HLJ1_G0048980.mRNA.1.CDS.1 × 2 （A0A6A5Q273） 20S proteasome × 2 （P32379） BJ4_G0043800.mRNA.1.CDS.1 × 2 （A0A6A5PTH4） Probable proteasome subunit alpha type-7 × 2 （A0A6A5Q4M4） BJ4_G0020160.mRNA.1.CDS.1 × 2 （A0A6A5PYC9） Proteasome endopeptidase complex × 2 （A0A6A5Q449） Proteasome endopeptidase complex × 2 （A0A6L0YA22） Proteasome subunit beta × 2 （A0A6A5Q0W2） Proteasome subunit beta type-5 × 2 （A0A6V8RU78） Proteasome endopeptidase complex × 2 （A0A6A5Q0P3） Proteasome subunit beta type-7 × 2 （P30657） MAGNESIUM ION × 8 CHLORIDE ION × 2 (2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid × 6 water × 27	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L0ZSP2_YEASX
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain N； PDBConstruct 1–196； UniProt 20–215 Author chain b； PDBConstruct 1–196； UniProt 20–215

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7o2l
Deposition date deposition_date	2021-03-30
Structure title title	Yeast 20S proteasome in complex with the covalently bound inhibitor b-lactone (2R,3S)-3-isopropyl-4-oxo-2-oxetane-carboxylate (IOC)
Keywords keywords	HYDROLASE-HYDROLASE INHIBITOR complex, Proteasome, b-lactone, Binding Analysis, HYDROLASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7o2l__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7o2l__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7o2l__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	60.42 Å
Rg (electron density)	59.96 Å
Total Rg	60.17 Å
Atom count	49366
Residues	6334
Excluded volume	878950 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7o2l__assembly_1__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	HLJ1_G0039880.mRNA.1.CDS.1
Molecular weight formula_weight	27191.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,O
Atom count atom_count	49492

MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL

Entity 2 Entity 2 polymer

Description description	BJ4_G0021480.mRNA.1.CDS.1
Molecular weight formula_weight	28748.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,P

MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGITKKDEDEEADEDMK

Entity 3 Entity 3 polymer

Description description	HLJ1_G0048980.mRNA.1.CDS.1
Molecular weight formula_weight	28478.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,Q

MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQQEQDKKKKSNH

Entity 4 Entity 4 polymer

Description description	20S proteasome
Molecular weight formula_weight	28649.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,R

MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAESPEEADVEMS

Entity 5 Entity 5 polymer

Description description	BJ4_G0043800.mRNA.1.CDS.1
Molecular weight formula_weight	25634.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,S

MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI

Entity 6 Entity 6 polymer

Description description	Probable proteasome subunit alpha type-7
Molecular weight formula_weight	31575.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,T

MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEINGDDDEDEDDSDNVMSSDDENAPVATNANATTDQEGDIHLE

Entity 7 Entity 7 polymer

Description description	BJ4_G0020160.mRNA.1.CDS.1
Molecular weight formula_weight	28033.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,U

MSGAAAASAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD

Entity 8 Entity 8 polymer

Description description	Proteasome endopeptidase complex
Molecular weight formula_weight	25114.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,V

TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICDIQEEQVDITA

Entity 9 Entity 9 polymer

Description description	Proteasome endopeptidase complex
Molecular weight formula_weight	22627.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,W

MSDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD

Entity 10 Entity 10 polymer

Description description	Proteasome subunit beta
Molecular weight formula_weight	22545.7 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,X

MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ

Entity 11 Entity 11 polymer

Description description	Proteasome subunit beta type-5
Molecular weight formula_weight	23325.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,Y

TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG

Entity 12 Entity 12 polymer

Description description	Proteasome endopeptidase complex
Molecular weight formula_weight	24883.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,Z

QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD

Entity 13 Entity 13 polymer

Description description	Proteasome subunit beta type-7
Molecular weight formula_weight	27200.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,a

TQIANAGASPMVNTQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPLADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI

Entity 14 Entity 14 polymer

Description description	Proteasome endopeptidase complex
Molecular weight formula_weight	21517.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,b

TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL

Entity 15 Entity 15 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 16 Entity 16 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 17 Entity 17 non-polymer

Description description	(2 {R},3 {S})-3-methanoyl-4-methyl-2-hydroxy-pentanoic acid
Molecular weight formula_weight	160.2 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 18 Entity 18 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	126

▼

6. Fold Classification (SCOP + CATH) 16 domains

CATH v4.4 (16 domains)

Domain ID domain_id	7o2lA01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lB01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lC01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lD01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lF01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lH01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lK01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lL01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lO01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lP01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lQ01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lR01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lT01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lV01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lY01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7o2lZ01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

▶

Unit-cell length a length_a	135.120 Å
Unit-cell length b length_b	301.500 Å
Unit-cell length c length_c	144.250 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	112.93 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.1798
R_work r_work	0.1779
R_free r_free	0.2158

Yeast 20S proteasome in complex with the covalently bound inhibitor b-lactone (2R,3S)-3-isopropyl-4-oxo-2-oxetane-carboxylate (IOC)

1. Protein Identity and Related Structures Protein Identity & Related Structures

HLJ1_G0039880.mRNA.1.CDS.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BJ4_G0021480.mRNA.1.CDS.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HLJ1_G0048980.mRNA.1.CDS.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

20S proteasome

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BJ4_G0043800.mRNA.1.CDS.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Probable proteasome subunit alpha type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BJ4_G0020160.mRNA.1.CDS.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome endopeptidase complex

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome endopeptidase complex

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer