4g4s

Structure of Proteasome-Pba1-Pba2 Complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome component C7-alpha

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome chaperone 1 × 2 （Q05778） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–252； UniProt 1–252

Proteasome component Y7

Saccharomyces cerevisiae

UniProt P23639

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome chaperone 1 × 2 （Q05778） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–250； UniProt 1–250

Proteasome component Y13

Saccharomyces cerevisiae

UniProt P23638

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome chaperone 1 × 2 （Q05778） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–258； UniProt 1–258

Proteasome component PRE6

Saccharomyces cerevisiae

UniProt P40303

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome chaperone 1 × 2 （Q05778） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–254； UniProt 1–254

Proteasome component PUP2

Saccharomyces cerevisiae

UniProt P32379

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome chaperone 1 × 2 （Q05778） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 2–261； UniProt 1–260

Proteasome component PRE5

Saccharomyces cerevisiae

UniProt P40302

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome chaperone 1 × 2 （Q05778） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 2–235； UniProt 1–234

Proteasome component C1

Saccharomyces cerevisiae

UniProt P21242

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome chaperone 1 × 2 （Q05778） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–288； UniProt 1–288

Proteasome component PRE3

Saccharomyces cerevisiae

UniProt P38624

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome chaperone 1 × 2 （Q05778） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB6_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–196； UniProt 20–215

Proteasome component PUP1

Saccharomyces cerevisiae

UniProt P25043

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome chaperone 1 × 2 （Q05778） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB7_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–232； UniProt 30–261

Proteasome component PUP3

Saccharomyces cerevisiae

UniProt P25451

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome chaperone 1 × 2 （Q05778） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB3_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–205； UniProt 1–205

Proteasome component C11

Saccharomyces cerevisiae

UniProt P22141

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome chaperone 1 × 2 （Q05778） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB2_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–198； UniProt 1–198

Proteasome component PRE2

Saccharomyces cerevisiae

UniProt P30656

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome chaperone 1 × 2 （Q05778） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB5_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–212； UniProt 76–287

Proteasome component C5

Saccharomyces cerevisiae

UniProt P23724

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component PRE4 × 2 （P30657） Proteasome chaperone 1 × 2 （Q05778） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB1_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–222； UniProt 20–241

Proteasome component PRE4

Saccharomyces cerevisiae

UniProt P30657

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome chaperone 1 × 2 （Q05778） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB4_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain N； PDBConstruct 1–233； UniProt 34–266

Proteasome chaperone 1

Saccharomyces cerevisiae

UniProt Q05778

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome assembly chaperone 2 × 2 （P36040） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POC1_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain O； PDBConstruct 1–276； UniProt 1–276

Proteasome assembly chaperone 2

Saccharomyces cerevisiae

UniProt P36040

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome chaperone 1 × 2 （Q05778） MAGNESIUM ION × 16 N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POC2_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain P； PDBConstruct 3–269； UniProt 1–267

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4g4s
Deposition date deposition_date	2012-07-16
Structure title title	Structure of Proteasome-Pba1-Pba2 Complex
Keywords keywords	Alpha Beta, Ntn-hydrolase, Peptide binding, HYDROLASE-CHAPERONE complex; HYDROLASE/CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4g4s__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4g4s__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4g4s__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	64.79 Å
Rg (electron density)	65.05 Å
Total Rg	65.21 Å
Atom count	55370
Residues	7088
Excluded volume	988150 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4g4s__assembly_1__model_1`	32-meric （32）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (19)

Entity 1 Entity 1 polymer

Description description	Proteasome component C7-alpha
Molecular weight formula_weight	28033.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	28531

MSGAAAASAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 2 Entity 2 polymer

Description description	Proteasome component Y7
Molecular weight formula_weight	27191.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 3 Entity 3 polymer

Description description	Proteasome component Y13
Molecular weight formula_weight	28748.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGITKKDEDEEADEDMK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 4 Entity 4 polymer

Description description	Proteasome component PRE6
Molecular weight formula_weight	28478.1 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQQEQDKKKKSNH

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 5 Entity 5 polymer

Description description	Proteasome component PUP2
Molecular weight formula_weight	28675.1 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

XMFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAESPEEADVEMS

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 6 Entity 6 polymer

Description description	Proteasome component PRE5
Molecular weight formula_weight	25660.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

XMFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 7 Entity 7 polymer

Description description	Proteasome component C1
Molecular weight formula_weight	31575.1 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEINGDDDEDEDDSDNVMSSDDENAPVATNANATTDQEGDIHLE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 8 Entity 8 polymer

Description description	Proteasome component PRE3
Molecular weight formula_weight	21517.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 9 Entity 9 polymer

Description description	Proteasome component PUP1
Molecular weight formula_weight	25114.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICDIQEEQVDITA

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 10 Entity 10 polymer

Description description	Proteasome component PUP3
Molecular weight formula_weight	22627.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 11 Entity 11 polymer

Description description	Proteasome component C11
Molecular weight formula_weight	22545.7 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 12 Entity 12 polymer

Description description	Proteasome component PRE2
Molecular weight formula_weight	23325.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 13 Entity 13 polymer

Description description	Proteasome component C5
Molecular weight formula_weight	24883.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 14 Entity 14 polymer

Description description	Proteasome component PRE4
Molecular weight formula_weight	25945.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

TQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPLADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 15 Entity 15 polymer

Description description	Proteasome chaperone 1
Molecular weight formula_weight	30718.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPLFPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGFSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 16 Entity 16 polymer

Description description	Proteasome assembly chaperone 2
Molecular weight formula_weight	30917.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

GPMSCLVLPLVSVGNIPQLSIDWLLNSQANEWEYLEALDSKYLVEFVGPLDRPEDGSDSLYKDADMKYSSALEVFYNKKRGLFAIQQRTPLVSVNYLNNFIVEIILPFLSKYNISEICIWDSLYAMEDENGVIVRPQEVYSLGEFYFDDEAELLSNLHLNDQESMVNNWLHFTPTSFQDKISVDQPIFKILFQILNASQRPKALRSIKYCSCLANEGDNSLDSQQFLQWIISQKVIKNAPPIVKFVRPISWQGAYGMADARDKFVDLYN

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 17 Entity 17 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 18 Entity 18 non-polymer

Description description	N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-4-methyl-1-oxopentan-2-yl]-L-leucinamide
Molecular weight formula_weight	475.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	846

▼

6. Fold Classification (SCOP + CATH) 31 domains

SCOP 2.08 (15 domains)

Domain ID domain_id	d4g4sa_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d4g4sb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d4g4sc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d4g4sd1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d4g4sd2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4g4se_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d4g4sf_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d4g4sg_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d4g4sh_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d4g4si_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d4g4sj_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d4g4sk_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d4g4sl_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d4g4sm_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d4g4sn_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

CATH v4.4 (16 domains)

Domain ID domain_id	4g4sA00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	4g4sB00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	4g4sC00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	4g4sD00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	4g4sE00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	4g4sF00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	4g4sG00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	4g4sH00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	4g4sI00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	4g4sJ00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	4g4sK00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	4g4sL00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	4g4sM00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	4g4sN00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	4g4sO01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	12120 — POC1 chaperone

Domain ID domain_id	4g4sP00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	10900 — PAC-like subunit

▶

Unit-cell length a length_a	132.409 Å
Unit-cell length b length_b	182.513 Å
Unit-cell length c length_c	388.782 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	2.490 Å
Low-resolution limit resolution_low	29.778 Å
R factor r_factor	0.1839
R_work r_work	0.1833
R_free r_free	0.2315

Structure of Proteasome-Pba1-Pba2 Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome component C7-alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component Y7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component Y13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component PRE6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component PUP2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component PRE5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component C1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component PRE3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component PUP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component PUP3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer