7lsx

Cryo-EM structure of 13S proteasome core particle assembly intermediate purified from Pre3-1 proteasome mutant (G34D)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Proteasome subunit alpha type-7 × 1 （P21242） Proteasome maturation factor UMP1 × 1 （P38293） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome chaperone 1 × 1 （Q05778） Proteasome assembly chaperone 2 × 1 （P36040）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–252； UniProt 1–252

Proteasome subunit alpha type-2

OrganismNot specified

UniProt P23639

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Proteasome subunit alpha type-7 × 1 （P21242） Proteasome maturation factor UMP1 × 1 （P38293） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome chaperone 1 × 1 （Q05778） Proteasome assembly chaperone 2 × 1 （P36040）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–250； UniProt 1–250

Proteasome subunit alpha type-3

OrganismNot specified

UniProt P23638

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Proteasome subunit alpha type-7 × 1 （P21242） Proteasome maturation factor UMP1 × 1 （P38293） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome chaperone 1 × 1 （Q05778） Proteasome assembly chaperone 2 × 1 （P36040）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–258； UniProt 1–258

Proteasome subunit alpha type-4

OrganismNot specified

UniProt P40303

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Proteasome subunit alpha type-7 × 1 （P21242） Proteasome maturation factor UMP1 × 1 （P38293） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome chaperone 1 × 1 （Q05778） Proteasome assembly chaperone 2 × 1 （P36040）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–254； UniProt 1–254

Proteasome subunit alpha type-5

OrganismNot specified

UniProt P32379

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-6 × 1 （P40302） Proteasome subunit alpha type-7 × 1 （P21242） Proteasome maturation factor UMP1 × 1 （P38293） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome chaperone 1 × 1 （Q05778） Proteasome assembly chaperone 2 × 1 （P36040）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–260； UniProt 1–260

Proteasome subunit alpha type-6

OrganismNot specified

UniProt P40302

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-7 × 1 （P21242） Proteasome maturation factor UMP1 × 1 （P38293） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome chaperone 1 × 1 （Q05778） Proteasome assembly chaperone 2 × 1 （P36040）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–234； UniProt 1–234

Proteasome subunit alpha type-7

OrganismNot specified

UniProt P21242

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Proteasome maturation factor UMP1 × 1 （P38293） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome chaperone 1 × 1 （Q05778） Proteasome assembly chaperone 2 × 1 （P36040）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–288； UniProt 1–288

Proteasome maturation factor UMP1

OrganismNot specified

UniProt P38293

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Proteasome subunit alpha type-7 × 1 （P21242） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome chaperone 1 × 1 （Q05778） Proteasome assembly chaperone 2 × 1 （P36040）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UMP1_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–148； UniProt 1–148

Proteasome subunit beta type-2

OrganismNot specified

UniProt P25043

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Proteasome subunit alpha type-7 × 1 （P21242） Proteasome maturation factor UMP1 × 1 （P38293） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome chaperone 1 × 1 （Q05778） Proteasome assembly chaperone 2 × 1 （P36040）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB2_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–261； UniProt 1–261

Proteasome subunit beta type-3

OrganismNot specified

UniProt P25451

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Proteasome subunit alpha type-7 × 1 （P21242） Proteasome maturation factor UMP1 × 1 （P38293） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-4 × 1 （P22141） Proteasome chaperone 1 × 1 （Q05778） Proteasome assembly chaperone 2 × 1 （P36040）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB3_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–205； UniProt 1–205

Proteasome subunit beta type-4

OrganismNot specified

UniProt P22141

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Proteasome subunit alpha type-7 × 1 （P21242） Proteasome maturation factor UMP1 × 1 （P38293） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome chaperone 1 × 1 （Q05778） Proteasome assembly chaperone 2 × 1 （P36040）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB4_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–198； UniProt 1–198

Proteasome chaperone 1

OrganismNot specified

UniProt Q05778

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Proteasome subunit alpha type-7 × 1 （P21242） Proteasome maturation factor UMP1 × 1 （P38293） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome assembly chaperone 2 × 1 （P36040）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POC1_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain O； PDBConstruct 1–276； UniProt 1–276

Proteasome assembly chaperone 2

OrganismNot specified

UniProt P36040

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Proteasome subunit alpha type-7 × 1 （P21242） Proteasome maturation factor UMP1 × 1 （P38293） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome chaperone 1 × 1 （Q05778）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POC2_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain P； PDBConstruct 1–267； UniProt 1–267

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7lsx
Deposition date deposition_date	2021-02-18
Structure title title	Cryo-EM structure of 13S proteasome core particle assembly intermediate purified from Pre3-1 proteasome mutant (G34D)
Keywords keywords	core particle, complex, assembly intermediate, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7lsx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7lsx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7lsx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	44.70 Å
Rg (electron density)	44.23 Å
Total Rg	44.63 Å
Atom count	44393
Residues	2838
Excluded volume	396750 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7lsx__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	Proteasome subunit alpha type-1
Molecular weight formula_weight	28033.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	44393

MSGAAAASAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD

Entity 2 Entity 2 polymer

Description description	Proteasome subunit alpha type-2
Molecular weight formula_weight	27191.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL

Entity 3 Entity 3 polymer

Description description	Proteasome subunit alpha type-3
Molecular weight formula_weight	28748.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGITKKDEDEEADEDMK

Entity 4 Entity 4 polymer

Description description	Proteasome subunit alpha type-4
Molecular weight formula_weight	28478.1 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQQEQDKKKKSNH

Entity 5 Entity 5 polymer

Description description	Proteasome subunit alpha type-5
Molecular weight formula_weight	28649.1 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAESPEEADVEMS

Entity 6 Entity 6 polymer

Description description	Proteasome subunit alpha type-6
Molecular weight formula_weight	25634.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI

Entity 7 Entity 7 polymer

Description description	Proteasome subunit alpha type-7
Molecular weight formula_weight	31575.1 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEINGDDDEDEDDSDNVMSSDDENAPVATNANATTDQEGDIHLE

Entity 8 Entity 8 polymer

Description description	Proteasome maturation factor UMP1
Molecular weight formula_weight	16777.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MNIVPQDTFKSQVSTDQDKSVLSSAVPSLPDTLRQQEGGAVPLSTQLNDRHPLESTLKNWETTQRQRQMEQYRQIFGIAEPMKRTMEMEIVNRTDFNPLSTNGSIHRDILLNKECSIDWEDVYPGTGLQASTMVGDDVHSKIEKQLGI

Entity 9 Entity 9 polymer

Description description	Proteasome subunit beta type-2
Molecular weight formula_weight	28299.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAGLSFDNYQRNNFLAENSHTQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICDIQEEQVDITA

Entity 10 Entity 10 polymer

Description description	Proteasome subunit beta type-3
Molecular weight formula_weight	22627.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD

Entity 11 Entity 11 polymer

Description description	Proteasome subunit beta type-4
Molecular weight formula_weight	22545.7 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ

Entity 12 Entity 12 polymer

Description description	Proteasome chaperone 1
Molecular weight formula_weight	30718.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPLFPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGFSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI

Entity 13 Entity 13 polymer

Description description	Proteasome assembly chaperone 2
Molecular weight formula_weight	30762.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MSCLVLPLVSVGNIPQLSIDWLLNSQANEWEYLEALDSKYLVEFVGPLDRPEDGSDSLYKDADMKYSSALEVFYNKKRGLFAIQQRTPLVSVNYLNNFIVEIILPFLSKYNISEICIWDSLYAMEDENGVIVRPQEVYSLGEFYFDDEAELLSNLHLNDQESMVNNWLHFTPTSFQDKISVDQPIFKILFQILNASQRPKALRSIKYCSCLANEGDNSLDSQQFLQWIISQKVIKNAPPIVKFVRPISWQGAYGMADARDKFVDLYN

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	7lsxB01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7lsxC01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7lsxD01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7lsxE01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7lsxG01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7lsxO01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	12120 — POC1 chaperone

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.61 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	76731

Cryo-EM structure of 13S proteasome core particle assembly intermediate purified from Pre3-1 proteasome mutant (G34D)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome maturation factor UMP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer