4v7o

Proteasome Activator Complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome component C7-alpha

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AA； PDBConstruct 1–243； UniProt 10–252 Author chain AC； PDBConstruct 1–243； UniProt 10–252 Author chain BA； PDBConstruct 1–243； UniProt 10–252 Author chain BO； PDBConstruct 1–243； UniProt 10–252

Proteasome component Y7

OrganismNot specified

UniProt P23639

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AG； PDBConstruct 1–231； UniProt 20–250 Author chain AS； PDBConstruct 1–231； UniProt 20–250 Author chain BB； PDBConstruct 1–231； UniProt 20–250 Author chain BP； PDBConstruct 1–231； UniProt 20–250

Proteasome component Y13

OrganismNot specified

UniProt P23638

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AH； PDBConstruct 1–232； UniProt 14–245 Author chain AT； PDBConstruct 1–232； UniProt 14–245 Author chain BC； PDBConstruct 1–232； UniProt 14–245 Author chain BQ； PDBConstruct 1–232； UniProt 14–245

Proteasome component PRE6

OrganismNot specified

UniProt P40303

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AI； PDBConstruct 1–227； UniProt 17–243 Author chain AU； PDBConstruct 1–227； UniProt 17–243 Author chain BD； PDBConstruct 1–227； UniProt 17–243 Author chain BR； PDBConstruct 1–227； UniProt 17–243

Proteasome component PUP2

OrganismNot specified

UniProt P32379

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AJ； PDBConstruct 1–250； UniProt 1–250 Author chain AV； PDBConstruct 1–250； UniProt 1–250 Author chain BE； PDBConstruct 1–250； UniProt 1–250 Author chain BS； PDBConstruct 1–250； UniProt 1–250

Proteasome component PRE5

OrganismNot specified

UniProt P40302

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AK； PDBConstruct 1–234； UniProt 1–234 Author chain AW； PDBConstruct 1–234； UniProt 1–234 Author chain BF； PDBConstruct 1–234； UniProt 1–234 Author chain BT； PDBConstruct 1–234； UniProt 1–234

Proteasome component C1

OrganismNot specified

UniProt P21242

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AL； PDBConstruct 1–244； UniProt 5–248 Author chain AX； PDBConstruct 1–244； UniProt 5–248 Author chain BG； PDBConstruct 1–244； UniProt 5–248 Author chain BU； PDBConstruct 1–244； UniProt 5–248

Proteasome component PRE3

OrganismNot specified

UniProt P38624

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB6_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AB； PDBConstruct 2–196； UniProt 21–215 Author chain AD； PDBConstruct 2–196； UniProt 21–215 Author chain BH； PDBConstruct 2–196； UniProt 21–215 Author chain BV； PDBConstruct 2–196； UniProt 21–215

Proteasome component PUP1

OrganismNot specified

UniProt P25043

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB7_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain AM； PDBConstruct 1–222； UniProt 30–251 Author chain AY； PDBConstruct 1–222； UniProt 30–251 Author chain BI； PDBConstruct 1–222； UniProt 30–251 Author chain BW； PDBConstruct 1–222； UniProt 30–251

Proteasome component PUP3

OrganismNot specified

UniProt P25451

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB3_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain AN； PDBConstruct 1–204； UniProt 2–205 Author chain AZ； PDBConstruct 1–204； UniProt 2–205 Author chain BJ； PDBConstruct 1–204； UniProt 2–205 Author chain BX； PDBConstruct 1–204； UniProt 2–205

Proteasome component C11

OrganismNot specified

UniProt P22141

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB2_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain A1； PDBConstruct 1–198； UniProt 1–198 Author chain AO； PDBConstruct 1–198； UniProt 1–198 Author chain BK； PDBConstruct 1–198； UniProt 1–198 Author chain BY； PDBConstruct 1–198； UniProt 1–198

Proteasome component PRE2

OrganismNot specified

UniProt P30656

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB5_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain A2； PDBConstruct 1–212； UniProt 76–287 Author chain AP； PDBConstruct 1–212； UniProt 76–287 Author chain BL； PDBConstruct 1–212； UniProt 76–287 Author chain BZ； PDBConstruct 1–212； UniProt 76–287

Proteasome component C5

OrganismNot specified

UniProt P23724

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component PRE4 × 2 （P30657） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB1_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain A3； PDBConstruct 1–222； UniProt 20–241 Author chain AQ； PDBConstruct 1–222； UniProt 20–241 Author chain B1； PDBConstruct 1–222； UniProt 20–241 Author chain BM； PDBConstruct 1–222； UniProt 20–241

Proteasome component PRE4

OrganismNot specified

UniProt P30657

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583） Proteasome activator BLM10 × 2 （P43583）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB4_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain A4； PDBConstruct 1–233； UniProt 34–266 Author chain AR； PDBConstruct 1–233； UniProt 34–266 Author chain B2； PDBConstruct 1–233； UniProt 34–266 Author chain BN； PDBConstruct 1–233； UniProt 34–266

Proteasome activator BLM10

OrganismNot specified

UniProt P43583

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 34	Proteasome component C7-alpha × 2 （P21243） Proteasome component Y7 × 2 （P23639） Proteasome component Y13 × 2 （P23638） Proteasome component PRE6 × 2 （P40303） Proteasome component PUP2 × 2 （P32379） Proteasome component PRE5 × 2 （P40302） Proteasome component C1 × 2 （P21242） Proteasome component PRE3 × 2 （P38624） Proteasome component PUP1 × 2 （P25043） Proteasome component PUP3 × 2 （P25451） Proteasome component C11 × 2 （P22141） Proteasome component PRE2 × 2 （P30656） Proteasome component C5 × 2 （P23724） Proteasome component PRE4 × 2 （P30657）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BLM10_YEAST
Isoform	—
PDB entities	15, 16, 17
Chains and sequence ranges	Author chain AE； PDBConstruct 1–76； UniProt 79–154 Author chain AF； PDBConstruct 1–76； UniProt 79–154 Author chain B3； PDBConstruct 1–76； UniProt 79–154 Author chain B6； PDBConstruct 1–76； UniProt 79–154 Author chain A5； PDBConstruct 1–799； UniProt 239–1037 Author chain A7； PDBConstruct 1–799； UniProt 239–1037 Author chain B4； PDBConstruct 1–799； UniProt 239–1037 Author chain B7； PDBConstruct 1–799； UniProt 239–1037 Author chain A6； PDBConstruct 1–997； UniProt 1147–2143 Author chain A8； PDBConstruct 1–997； UniProt 1147–2143 Author chain B5； PDBConstruct 1–997； UniProt 1147–2143 Author chain B8； PDBConstruct 1–997； UniProt 1147–2143

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4v7o
Deposition date deposition_date	2009-12-22
Structure title title	Proteasome Activator Complex
Keywords keywords	20S Proteasome BLM10, Hydrolase, Nucleus, Phosphoprotein, Protease, Proteasome, Threonine protease, Isopeptide bond, Zymogen; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4v7o__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4v7o__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4v7o__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	81.88 Å
Rg (electron density)	82.85 Å
Total Rg	82.79 Å
Atom count	79450
Residues	10038
Excluded volume	1419000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4v7o__assembly_1__model_1`	34-meric （34）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4v7o__assembly_2__model_1`	34-meric （34）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	Proteasome component C7-alpha
Molecular weight formula_weight	27316.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AC,BA,BO
Atom count atom_count	158904

AGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD

Entity 2 Entity 2 polymer

Description description	Proteasome component Y7
Molecular weight formula_weight	25112.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AG,AS,BB,BP

QIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL

Entity 3 Entity 3 polymer

Description description	Proteasome component Y13
Molecular weight formula_weight	25606.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AH,AT,BC,BQ

SPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGIT

Entity 4 Entity 4 polymer

Description description	Proteasome component PRE6
Molecular weight formula_weight	25384.7 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AI,AU,BD,BR

IFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQ

Entity 5 Entity 5 polymer

Description description	Proteasome component PUP2
Molecular weight formula_weight	27574.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ,AV,BE,BS

MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAE

Entity 6 Entity 6 polymer

Description description	Proteasome component PRE5
Molecular weight formula_weight	25634.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK,AW,BF,BT

MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI

Entity 7 Entity 7 polymer

Description description	Proteasome component C1
Molecular weight formula_weight	26892.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL,AX,BG,BU

GTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEIN

Entity 8 Entity 8 polymer

Description description	Proteasome component PRE3
Molecular weight formula_weight	21487.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB,AD,BH,BV

ASIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL

Entity 9 Entity 9 polymer

Description description	Proteasome component PUP1
Molecular weight formula_weight	23987.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AM,AY,BI,BW

TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICD

Entity 10 Entity 10 polymer

Description description	Proteasome component PUP3
Molecular weight formula_weight	22496.6 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AN,AZ,BJ,BX

SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD

Entity 11 Entity 11 polymer

Description description	Proteasome component C11
Molecular weight formula_weight	22545.7 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AO,A1,BK,BY

MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ

Entity 12 Entity 12 polymer

Description description	Proteasome component PRE2
Molecular weight formula_weight	23353.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AP,A2,BL,BZ

TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKRVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG

Entity 13 Entity 13 polymer

Description description	Proteasome component C5
Molecular weight formula_weight	24883.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AQ,A3,BM,B1

QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD

Entity 14 Entity 14 polymer

Description description	Proteasome component PRE4
Molecular weight formula_weight	25945.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AR,A4,BN,B2

TQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPLADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI

Entity 15 Entity 15 polymer

Description description	Proteasome activator BLM10
Molecular weight formula_weight	9103.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AE,AF,B3,B6

TSLLNERLQHYTLDYVSDRAQHMKNIYDPSSRWFSRSVRPEFPIEEFLPYKTESHEDQAKYLCHVLVNLYIAISSL

Entity 16 Entity 16 polymer

Description description	Proteasome activator BLM10
Molecular weight formula_weight	92568.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A5,A7,B4,B7

NVNHWTNELKNCLHFDFPVALRKSLATVYYYLSLVQGQKVYRQMHVDMFERLVSLDDDRTQFTELLQKQGLLLDHQIMLNFLCEFLPYPDPDYARYELSSKEDLQLFRLLLKHAHNAKPFFDKSKESLLVDTMNFLLSSLAPSTMMAVMPIVTSVVPYHYHIHSKIIDYFPFCYSIWSSVSANVAIDTHMYDFVGSISKDVHNKILSSEHEKDVVGVEFGEFGIFTDDQMTFMFNRLQGHLRTDGQIHSYSRTVKPFVYAINGSKKDRFFEKLVSLAKAIETFIHPSNNGFWTKPNAKFVHAFIKSYHGRVKYEEDICARGVTNGICLTSFCHEEIVEIFLNIISLGSQNKNPDIANYYISCFAYLLELDPSNAYLIYDKILIDLYDTLADQFINSRHRIISSLKQFTRVIRFIVMDKLYRVHITNVLSMLVSKLDMNDTNLTSNLINGIVSIAAFIPIQDLTGEDDYISFESDTLPLVQQHFYHIKCGESSKTFRVDDELLNNAFKASTTVFQSMLKVYVEKIFQLVDVDLEDSLVTKINQTTMILQESMDDKIFNYFASLLNRNFWSNDSFKEKDPNYELVTIPLAALVRRNNGLSKELVRTLLFHIKEQIKRGAGSVRSTSEIQQRDVKLVLYLTALNDVLRNCHESLLEYSDELITFMKYLYDNVTNPPLDVITSIVIHSALATLCTTEITDCRLFPEDSKIPEKDRWGGLQFDPRRFDKQHLSFQWHVPSSDEITLSISILESLSEYCINNVEELMKAPRHDSEYGDMIQKYVLVMTHTLSGSSLLFDPDFNKY

Entity 17 Entity 17 polymer

Description description	Proteasome activator BLM10
Molecular weight formula_weight	114622.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A6,A8,B5,B8

LDIYTCNYYFGNTTEEKLQNPNYLNVHRVRARIGHFFHKLYVFLSTNFENNTNMFQILLHGLKVWFTDLGQETVFNEDPNAFIDVDFLENVQSLSHVNEPFTRTNFAIRANSLHQSRVLLHSTNRKASKLENLLLVDIIQLATSLYPDIYKPAQGTLVHCMKQLVGSYGVVINKIIPSLEKAIKDHDYMKIQVILNVLLIKKIHRKLMTDYKDIGRLIFLLIECCRVNELEIGMYADKILTDIVIGIKIPSSVCVISDQAFLPLAPPDGTINLQVEAVKLAKKKKREYYLSLLVDLQDKLLDKLDNEKDMGWKIRMFILRFVTQIQSNLESKPDKRAVFSIISQISTKHPEIIHLVVKSLLSTCNKIISLSDYEYDITRAYKNEFNPSFVEILDTSTTSFPKTFTEEMNNFDNPKYFIDLRAYVGWLCWGRLMYVMSPKALKLNLRENELEVLKTAGHLLTREFLRDVTMNLVQDNETRGVFSSGNVSFFSLVILLISSGFCELNMSDLFELCESYYNKDDKASMIMSVEIVAGLVCGSKFMSVSDLDKRDTFIENFLAKCLDYELNHDAFEIWSTLAWWLPAVVDLRRSKTFFCHFINADGMFDRESDAATHQTSKIYMLRSILMSMEFRAPDVGKLFDELVFDHPYDQVRQAVAKLLTTLVQNQSNPSISDPTTLLEAERNDPDGLGLPLKSVPEKVDAYIKKQFEIIKNLEDSVVGLNPQQFIKTDYFYRTSTIFYWIKEMARGPNKVLLVPYLVDYVLPFLIGLVKHKDVCALASLDPVRLYAGLGYMPIRKNHVAAIVDYVCSSNVALSSNQTKLQLAFIQHFLSAELLQLTEEEKNKILEFVVSNLYNEQFVEVRVRAASILSDIVHNWKEEQPLLSLIERFAKGLDVNKYTSKERQKLSKTDIKIHGNVLGLGAIISAFPYVFPLPPWIPKNLSNLSSWARTSGMTGNAAKNTISEFKKVRADTWKFDRASFNTEELEDLEGVLWRSYYA

▶

Unit-cell length a length_a	236.116 Å
Unit-cell length b length_b	127.739 Å
Unit-cell length c length_c	532.668 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	102.85 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.005 Å
Low-resolution limit resolution_low	29.994 Å
R factor r_factor	0.1960
R_work r_work	0.1960
R_free r_free	0.2500

Proteasome Activator Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome component C7-alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component Y7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component Y13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component PRE6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component PUP2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component PRE5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component C1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component PRE3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component PUP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component PUP3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer