6ef1

Yeast 26S proteasome bound to ubiquitinated substrate (5D motor state)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-1

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） model substrate polypeptide × 1 ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–239； UniProt 13–251

Proteasome subunit alpha type-2

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P23639

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） model substrate polypeptide × 1 ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–250； UniProt 1–250

Proteasome subunit alpha type-3

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P23638

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） model substrate polypeptide × 1 ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–238； UniProt 8–245

Proteasome subunit alpha type-4

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P40303

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） model substrate polypeptide × 1 ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–234； UniProt 9–242

Proteasome subunit alpha type-5

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P32379

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） model substrate polypeptide × 1 ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–242； UniProt 9–250

Proteasome subunit alpha type-6

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P40302

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） model substrate polypeptide × 1 ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–233； UniProt 2–234

Probable proteasome subunit alpha type-7

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P21242

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） model substrate polypeptide × 1 ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–243； UniProt 6–248

26S proteasome regulatory subunit 7 homolog

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P33299

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） model substrate polypeptide × 1 ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS7_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–262； UniProt 194–455

26S proteasome regulatory subunit 4 homolog

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P40327

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） model substrate polypeptide × 1 ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS4_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–271； UniProt 167–437

26S proteasome regulatory subunit 8 homolog

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q01939

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） model substrate polypeptide × 1 ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS8_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–273； UniProt 133–405

26S proteasome regulatory subunit 6B homolog

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P33298

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） model substrate polypeptide × 1 ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS6B_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–276； UniProt 153–428

26S proteasome subunit RPT4

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P53549

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome regulatory subunit 6A × 1 （P33297） model substrate polypeptide × 1 ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS10_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–271； UniProt 166–436

26S proteasome regulatory subunit 6A

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P33297

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） model substrate polypeptide × 1 ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS6A_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–262； UniProt 173–434

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ef1
Deposition date deposition_date	2018-08-15
Structure title title	Yeast 26S proteasome bound to ubiquitinated substrate (5D motor state)
Keywords keywords	26S Proteasome, ATPase, AAA+, Protease, Motor protein, Ubiquitin; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ef1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ef1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ef1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	47.46 Å
Rg (electron density)	46.58 Å
Total Rg	46.96 Å
Atom count	23658
Residues	3294
Excluded volume	418250 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ef1__assembly_1__model_1`	tetradecameric （14）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Proteasome subunit alpha type-1
Molecular weight formula_weight	26909.6 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	23658

DRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQ

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 2 Entity 2 polymer

Description description	Proteasome subunit alpha type-2
Molecular weight formula_weight	27191.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 3 Entity 3 polymer

Description description	Proteasome subunit alpha type-3
Molecular weight formula_weight	26313.6 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

SRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGIT

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 4 Entity 4 polymer

Description description	Proteasome subunit alpha type-4
Molecular weight formula_weight	26098.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

SIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQE

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 5 Entity 5 polymer

Description description	Proteasome subunit alpha type-5
Molecular weight formula_weight	26544.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

DRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAE

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 6 Entity 6 polymer

Description description	Proteasome subunit alpha type-6
Molecular weight formula_weight	25502.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

FRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 7 Entity 7 polymer

Description description	Probable proteasome subunit alpha type-7
Molecular weight formula_weight	26835.4 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

TGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEIN

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 8 Entity 8 polymer

Description description	26S proteasome regulatory subunit 7 homolog
Molecular weight formula_weight	29070.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

SVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 9 Entity 9 polymer

Description description	26S proteasome regulatory subunit 4 homolog
Molecular weight formula_weight	30125.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYL

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 10 Entity 10 polymer

Description description	26S proteasome regulatory subunit 8 homolog
Molecular weight formula_weight	30239.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

LVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQETAISVAKLFK

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 11 Entity 11 polymer

Description description	26S proteasome regulatory subunit 6B homolog
Molecular weight formula_weight	30792.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

DSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKFDFYK

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 12 Entity 12 polymer

Description description	26S proteasome subunit RPT4
Molecular weight formula_weight	30174.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

LVYNMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKKLEGTIEYQK

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 13 Entity 13 polymer

Description description	26S proteasome regulatory subunit 6A
Molecular weight formula_weight	28942.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

DEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQARKSKSVSFYA

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 14 Entity 14 polymer

Description description	model substrate polypeptide
Molecular weight formula_weight	1458.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

NENVSARLGGASIAV

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21

Entity 15 Entity 15 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 16 Entity 16 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.73 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	31019

Yeast 26S proteasome bound to ubiquitinated substrate (5D motor state)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Probable proteasome subunit alpha type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit 7 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit 4 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit 8 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer