9euh

Cryo-EM structure of Staphylococcus aureus bacteriophage phi812 baseplate in the pre-contraction state - core, and wedge module proteins

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Peptidase C51 domain-containing protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	TmpF × 6 （A0A0U1WGD3） Baseplate wedge subunit × 6 （A0A0U1UXD7） Baseplate component × 6 （A0A0U1UXD6） Putative baseplate component × 6 （A0A0U1X2L4） Baseplate component × 12 （A0A0U1WF63） GP-PDE domain-containing protein × 3 （A0A0U1WFD7） NlpC/P60 domain-containing protein × 3 （A0A0U1UXW0）	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1X189_9CAUD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 1–808； UniProt 1–808

TmpF

OrganismNot specified

UniProt A0A0U1WGD3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Peptidase C51 domain-containing protein × 3 （A0A0U1X189） Baseplate wedge subunit × 6 （A0A0U1UXD7） Baseplate component × 6 （A0A0U1UXD6） Putative baseplate component × 6 （A0A0U1X2L4） Baseplate component × 12 （A0A0U1WF63） GP-PDE domain-containing protein × 3 （A0A0U1WFD7） NlpC/P60 domain-containing protein × 3 （A0A0U1UXW0）	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WGD3_9CAUD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–1019； UniProt 1–1019 Author chain J； PDBConstruct 1–1019； UniProt 1–1019

Baseplate wedge subunit

OrganismNot specified

UniProt A0A0U1UXD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Peptidase C51 domain-containing protein × 3 （A0A0U1X189） TmpF × 6 （A0A0U1WGD3） Baseplate component × 6 （A0A0U1UXD6） Putative baseplate component × 6 （A0A0U1X2L4） Baseplate component × 12 （A0A0U1WF63） GP-PDE domain-containing protein × 3 （A0A0U1WFD7） NlpC/P60 domain-containing protein × 3 （A0A0U1UXW0）	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1UXD7_9CAUD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain L； PDBConstruct 1–234； UniProt 1–234 Author chain O； PDBConstruct 1–234； UniProt 1–234

Baseplate component

OrganismNot specified

UniProt A0A0U1UXD6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Peptidase C51 domain-containing protein × 3 （A0A0U1X189） TmpF × 6 （A0A0U1WGD3） Baseplate wedge subunit × 6 （A0A0U1UXD7） Putative baseplate component × 6 （A0A0U1X2L4） Baseplate component × 12 （A0A0U1WF63） GP-PDE domain-containing protein × 3 （A0A0U1WFD7） NlpC/P60 domain-containing protein × 3 （A0A0U1UXW0）	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1UXD6_9CAUD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 1–174； UniProt 1–174 Author chain G； PDBConstruct 1–174； UniProt 1–174

Putative baseplate component

OrganismNot specified

UniProt A0A0U1X2L4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Peptidase C51 domain-containing protein × 3 （A0A0U1X189） TmpF × 6 （A0A0U1WGD3） Baseplate wedge subunit × 6 （A0A0U1UXD7） Baseplate component × 6 （A0A0U1UXD6） Baseplate component × 12 （A0A0U1WF63） GP-PDE domain-containing protein × 3 （A0A0U1WFD7） NlpC/P60 domain-containing protein × 3 （A0A0U1UXW0）	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1X2L4_9CAUD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain M； PDBConstruct 1–263； UniProt 1–263 Author chain N； PDBConstruct 1–263； UniProt 1–263

Baseplate component

OrganismNot specified

UniProt A0A0U1WF63

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Peptidase C51 domain-containing protein × 3 （A0A0U1X189） TmpF × 6 （A0A0U1WGD3） Baseplate wedge subunit × 6 （A0A0U1UXD7） Baseplate component × 6 （A0A0U1UXD6） Putative baseplate component × 6 （A0A0U1X2L4） GP-PDE domain-containing protein × 3 （A0A0U1WFD7） NlpC/P60 domain-containing protein × 3 （A0A0U1UXW0）	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WF63_9CAUD
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain C； PDBConstruct 1–348； UniProt 1–348 Author chain D； PDBConstruct 1–348； UniProt 1–348 Author chain I； PDBConstruct 1–348； UniProt 1–348 Author chain K； PDBConstruct 1–348； UniProt 1–348

GP-PDE domain-containing protein

OrganismNot specified

UniProt A0A0U1WFD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Peptidase C51 domain-containing protein × 3 （A0A0U1X189） TmpF × 6 （A0A0U1WGD3） Baseplate wedge subunit × 6 （A0A0U1UXD7） Baseplate component × 6 （A0A0U1UXD6） Putative baseplate component × 6 （A0A0U1X2L4） Baseplate component × 12 （A0A0U1WF63） NlpC/P60 domain-containing protein × 3 （A0A0U1UXW0）	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WFD7_9CAUD
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain B； PDBConstruct 1–848； UniProt 1–848

NlpC/P60 domain-containing protein

OrganismNot specified

UniProt A0A0U1UXW0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Peptidase C51 domain-containing protein × 3 （A0A0U1X189） TmpF × 6 （A0A0U1WGD3） Baseplate wedge subunit × 6 （A0A0U1UXD7） Baseplate component × 6 （A0A0U1UXD6） Putative baseplate component × 6 （A0A0U1X2L4） Baseplate component × 12 （A0A0U1WF63） GP-PDE domain-containing protein × 3 （A0A0U1WFD7）	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1UXW0_9CAUD
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain A； PDBConstruct 1–295； UniProt 1–295

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9euh
Deposition date deposition_date	2024-03-27
Structure title title	Cryo-EM structure of Staphylococcus aureus bacteriophage phi812 baseplate in the pre-contraction state - core, and wedge module proteins
Keywords keywords	bacteriophage, phage, contractile, phi812, baseplate, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9euh__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9euh__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9euh__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	71.54 Å
Rg (electron density)	70.97 Å
Total Rg	71.17 Å
Atom count	92691
Residues	11568
Excluded volume	1646300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9euh__assembly_1__model_1`	15-meric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Peptidase C51 domain-containing protein
Molecular weight formula_weight	91364.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E
Atom count atom_count	30897

MRRIRRPKVRIEIVTDDNTFTLRFEDTRDYNGDEFGAKLLGFQTKNSMEDDSSVFQINMAGDTYWDKLVMANDIIRIFITPNDDPNDKEGKQERLIQVGMVSQVSKVGSYGNDQTQFRITGQSFVKPFMKFGLGVIQEVQAVLPEVGWLIDGDGDNEVKFTGSSAHEVMTGIIRRFIPYMKYNYTEKTYNTIDNYLDYDDLSSWDEFEKLTEVSAFTNFDGSLKQLMDMVTARPFNELFFKNSEKTPGKAQLVLRKTPFNPTEWRALDMIKVPTEDFIEEDVGKSDVETYSIFTATPAGMLKELNGDVFSKPQFHPELTDRYGYTKFEVENIYLSTKSGSATEDSDSSGDDNGTERGTYSKIMKDLSNYGRDNISKGIDKYTSKLSSKYKNLKKAQAKKIIEKFVKEGKVTEKEYEKITGNKVDDELTSDNRPKLTKDKLKSILKEKFKTQDDFNNSKKKKKAKTDALKELTTKYRFGNKTHATTLLDEYIKYKGEPPNDEAFDKYLKAIEGVSNVATDTGSDASDSPLVMFSRMLFNWYHGNPNFYAGDIIVLGDPKYDLGKRLFIEDKQRGDTWEFYIESVEHKFDYKQGYYTTVGVTRGLKDAILEDGKGSPHRFAGLWNQSSDFMGGLMGEDTSKELKEKGVAEKQSSGDKDGGSDSGGAQDGGSLDSLKKYNGKLPKHDPSFVQPGNRHYKYQCTWYAYNRRGQLGIPVPLWGDAADWIGGAKGAGYGVGRTPKQGACVIWQRGVQGGSPQYGHVAFVEKVLDGGKKIFISEHNYATPNGYGTRTIDMSSAIGKNAQFIYDKK

Entity 2 Entity 2 polymer

Description description	TmpF
Molecular weight formula_weight	116389.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,H

MANFLKNLHPLLRRDRNKKDNQDPNFALIDALNEEMNQVEKDAIESKLQSSLKTSTSEYLDKFGDWFGVYRKTDEKDDVYRARIIKYLLLKRGTNNAIIDAIKDYLGRDDIDVSVYEPFTNIFYTNKSHLNGEDHLMGYYYRFAVINVSIGDYFPVEIIDVINEFKPAGVTLYVTYDGASTIRGGAIIKWLDGLPKIETYQEFDRFTGYDDTFYGHINMNQSKDTDNSSSDIFKTNHSLINSLDVLTGSSSVGRQYINYGYVTSYVYNPGMTSSVNQISASTEGRGQEVPTDYYMYTSTKNNNTVELSMQTTSGVSYLYNNFNFRDYMSKYRPQVDLQSDEARRIVSDYIKELSIDYYLSAVIPPDESIEIKLQVYDFSINRWLTVSINNLSFYEKNIGSNIGYIKDYLNSELNMFTRLEINAGKRDSVDIKVNYLDLMFYYYERGIYTIKPYKALIENYLDISRETYVEAFKIASLSNGDIITKTGFQPIGYLKLVGNYENTIPSTINIVAKDTDNNPIESNELDVYNTVENRNLLQSYKGVNTIAREITSTKEFTVSGWAKEIYSTNYLSKVLKPGKVYTLSFDMEITGNDPTLKSYSDNHGIYLYSNTKGIVVNGVKSMERTIGNKVSVTQTFTAPTITDHRLLIYTGRYTSDGKASTPPVFFNTVKITELKLTEGSSKLEYSPAPEDKPNVIEKGIKFNNILTNIQTLSINSDTILKNVTLYYSYYGDSWVELKTLGNISTGETTETNNLIDLYGLQTVDYSNINPMSKVSLRSIWNVKLGELNNQEGSLSNMPNDYFNAVWQDIDKLSDIELGSMRMVKDTEGGVFDGATGEIIKATLFNVGAYTDLDMLAYTLTNYTEPLTLGSSRLISELKEELLTSESFNVDNRIKVIDSIYEELPNTSIIKNGFVEREVTGSKYLDYGLYEPIEDGTRYKLIVEGEFKDNIEFISLYNSNPNFNETFIYPSEIINGVAEKEFIAKPSTEDKPRLNTDVRIYIRPYDSTISKVRRVELRKV

Entity 3 Entity 3 polymer

Description description	Baseplate wedge subunit
Molecular weight formula_weight	26611.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,L

MRFKKHVVQHEETMQAIAQRYYGDVSYWIDLVEHNNLKYPYLVETDEEKMKDPERLASTGDTLIIPIESDLTDVSAKEINSRDKDVLVELALGRDLNITADEKYFNEHGTSDNILAFSTNGNGDLDTVKGIDNMKQQLQARLLTPRGSLMLHPNYGSDLHNLFGLNIPEQATLIEMEVLRTLTSDNRVKSANLIDWKIQGNVYSGQFSVEIKSVEESINFVLGQDEEGIFALFE

Entity 4 Entity 4 polymer

Description description	Baseplate component
Molecular weight formula_weight	19998.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,F

MNNFIPQPQGLLRFLNTLDTDLTSSHMNLLDEEVSFVSKFYTPQLQLSELAKKVLTNIKTDDIPVLEREFNDNTIIHKANDTLLKVQAPRMYMILQSIVLEAYAIVNCFVENPSSLKYLTEEDVSITRENLNYVADYLGNYDDYNSVVLDLRDLDLCFSAIELQLPLIKKEANV

Entity 5 Entity 5 polymer

Description description	Putative baseplate component
Molecular weight formula_weight	29381.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N

MPQSDGISNLHRIALRFPKEGGGYDMYRFKVNPENYTIDSPQRTTAIKTKSDIVIEDYGKDIEVINFTGTTGFRPVREADGLKTGKQKMEELQSRVSEYAMQGGSGNVSGSYLQFFNFTDDSYYKVHLAPQGLKITRSKDEPLLFRYEITLVVIGSLTEADRSAVTTEEFGNVKPNASQRVDEGIKELDKNARKTRDRNNQEISRRENTIPKSTGDNTNEGNRLKQSFPSSSIYNPRQSTNGLKGNIDNMALIIGYGDGGVSS

Entity 6 Entity 6 polymer

Description description	Baseplate component
Molecular weight formula_weight	39248.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,I,C,K

MKTRKLTNILSKLIDKTMAGTSKITDFTPGSASRSLLEAVSLEIEQFYILTKENIDWGIQEGIIEAFDFQKRQSKRAYGDVTIQFYQPLDMRMYIPAGTTFTSTRQEYPQQFETLVDYYAEPDSTEIVVEVYCKETGVAGNVPEGTINTIASGSSLIRSVNNEYSFNTGTKEESQEDFKRRFHSFVESRGRATNKSVRYGALQIPDVEGVYVYEETGHITVFAHDRNGNLSDTLKEDIIDALQDYRPSGIMLDVTGVEKEEVNVSATVTISNKSRIGDTLQKHIESVIRSYLNNLKTSDDLIITDLIQAIMNIDDVLIYDVSFDNLDENIIVPPQGIIRAGEIKVELK

Entity 7 Entity 7 polymer

Description description	GP-PDE domain-containing protein
Molecular weight formula_weight	96199.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MVVRFQSSMGRSLKRVDSDDLNVKGLVLATVSKINYKYQSVEVKVNNLTLGSRIGDDGSLAVPYPKSFIGRTPEGSVFGTKPLITEGSVVLIGFLNDDINSPIILSVYGDNEQNKMINTNPLDGGKFDTESVYKYSSSLYEILPSLNYKYDDGEGTSIRTYNGKSFFSMTSGEEEKPQATDFYTGTEYQDLFTSYYGNKTLIEPRIQKAPNMLFKHQGVFYDDGTPDNHITTLFISERGDIRASVLNTETQKRTTQEMSSDGSYRVIKQDDDLMLDEAQVWIEYGISEDNKFYIKNDKHKFEFTDEGIYIDDKPMLENLDESIAEAMKNLNEIQKELDDINYLLKGVGKDNLEELIESTKESIEASKKATSDVNRLTTQIAEVSGRTEGIITQFQKFRDETFKDFYEDASTVINEVNQNFPTMKTDVKTLKTKVDNLEKTEIPNIKTRLTELENNNNNADKIISDRGEHIGAMIQLEENVTVPMRKYMPIPWSKVTYNNAEFWDSNNPTRLVVPKGITKVRVAGNVLWDSNATGQRMLRILKNGTYSIGLPYTRDVAISTAPQNGTSGVIPVKEGDYFEFEAFQDSEGDRQFRADPYTWFSIEAIELETETMEKDFMLIGHRGATGYTDEHTIKGYQMALDKGADYIELDLQLTKDNKLLCMHDSTIDRTTTGTGKVGDMTLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDANMDRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESEMDDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEEMQSLIQMGVDGFFTNYLDEYKKI

Entity 8 Entity 8 polymer

Description description	NlpC/P60 domain-containing protein
Molecular weight formula_weight	34645.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MATDKEAKDVIDKFIDNVFNFDVLTKERIKEKDEEIKKITTDDMYEKVVYIRPYVGVIQSLNPQHVQYESFSNNGYDIEAELSFRKVSYLVDKGSIPTDSLSTLTVHLVERNQELLIDYFDEIQDVLYGEYMEEEYVFDEDVPLSTILALDLNDNLKSLSNIKYMFKGAPKENPFGTDKDVYIDTYNLLYWLYLGEDEELAYPMNINYFFTEGRFFTIFGKGHKYKVDVSKFIVGDILFFGRSDTNIGIYVGDGEFISMMGKFPKDETPIGKYKLDDYWNEFNGRVMRFDEEVYI

▶

Resolution resolution	4.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	9705

Cryo-EM structure of Staphylococcus aureus bacteriophage phi812 baseplate in the pre-contraction state - core, and wedge module proteins

1. Protein Identity and Related Structures Protein Identity & Related Structures

Peptidase C51 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

TmpF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative baseplate component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

GP-PDE domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NlpC/P60 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9euh__assembly_1__model_1

9euh__assembly_1__model_1 | I(q)

9euh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer