SAXSdb — 9fwv

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carboxysome assembly protein CcmM

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ribulose bisphosphate carboxylase large chain × 8 （Q31NB3） Ribulose bisphosphate carboxylase small subunit × 8 （P04716）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CCMM_SYNE7
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–86； UniProt 225–310 Author chain B； PDBConstruct 1–86； UniProt 225–310 Author chain F； PDBConstruct 1–86； UniProt 225–310 Author chain T； PDBConstruct 1–86； UniProt 225–310

Ribulose bisphosphate carboxylase large chain

OrganismNot specified

UniProt Q31NB3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Carboxysome assembly protein CcmM × 4 （Q03513） Ribulose bisphosphate carboxylase small subunit × 8 （P04716）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBL_SYNE7
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–442； UniProt 17–458 Author chain G； PDBConstruct 1–442； UniProt 17–458 Author chain H； PDBConstruct 1–442； UniProt 17–458 Author chain I； PDBConstruct 1–442； UniProt 17–458 Author chain J； PDBConstruct 1–442； UniProt 17–458 Author chain Q； PDBConstruct 1–442； UniProt 17–458 Author chain R； PDBConstruct 1–442； UniProt 17–458 Author chain S； PDBConstruct 1–442； UniProt 17–458

Ribulose bisphosphate carboxylase small subunit

OrganismNot specified

UniProt P04716

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Carboxysome assembly protein CcmM × 4 （Q03513） Ribulose bisphosphate carboxylase large chain × 8 （Q31NB3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBS_SYNP6
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–101； UniProt 8–108 Author chain E； PDBConstruct 1–101； UniProt 8–108 Author chain K； PDBConstruct 1–101； UniProt 8–108 Author chain L； PDBConstruct 1–101； UniProt 8–108 Author chain M； PDBConstruct 1–101； UniProt 8–108 Author chain N； PDBConstruct 1–101； UniProt 8–108 Author chain O； PDBConstruct 1–101； UniProt 8–108 Author chain P； PDBConstruct 1–101； UniProt 8–108

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9fwv
Deposition date deposition_date	2024-07-01
Structure title title	Rubisco in native beta-carboxysomes
Keywords keywords	Rubisco, CcmM, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9fwv__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9fwv__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9fwv__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	48.36 Å
Rg (electron density)	47.35 Å
Total Rg	47.66 Å
Atom count	36308
Residues	4560
Excluded volume	641940 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9fwv__assembly_1__model_1`	20-meric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Carboxysome assembly protein CcmM
Molecular weight formula_weight	9944.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,F,T
Atom count atom_count	36308

LSSEVITQVRSLLNQGYRIGTEHADKRRFRTSSWQPCAPIQSTNERQVLSELENCLSEHEGEYVRLLGIDTNTRSRVFEALIQRPD

Entity 2 Entity 2 polymer

Description description	Ribulose bisphosphate carboxylase large chain
Molecular weight formula_weight	49050.6 kDa
EC 编号 ec_number	4.1.1.39
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G,H,I,J,Q,R,S

YKLTYYTPDYTPKDTDLLAAFRFSPQPGVPADEAGAAIAAESSTGTWTTVWTDLLTDMDRYKGKCYHIEPVQGEENSYFAFIAYPLDLFEEGSVTNILTSIVGNVFGFKAIRSLRLEDIRFPVALVKTFQGPPHGIQVERDLLNKYGRPMLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFVADAIHKSQAETGEIKGHYLNVTAPTCEEMMKRAEFAKELGMPIIMHDFLTAGFTANTTLAKWCRDNGVLLHIHRAMHAVIDRQRNHGIHFRVLAKCLRLSGGDHLHSGTVVGKLEGDKASTLGFVDLMREDHIEADRSRGVFFTQDWASMPGVLPVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATANRVALEACVQARNEGRDLYREGGDILREAGKWSPELAAALDL

Entity 3 Entity 3 polymer

Description description	Ribulose bisphosphate carboxylase small subunit
Molecular weight formula_weight	12181.8 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,K,L,M,N,O,P

KERRFETFSYLPPLSDRQIAAQIEYMIEQGFHPLIEFNEHSNPEEFYWTMWKLPLFDCKSPQQVLDEVRECRSEYGDCYIRVAGFDNIKQCQTVSFIVHRP

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	185

Rubisco in native beta-carboxysomes

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carboxysome assembly protein CcmM

State in the Current Structure

Other States of the Same Protein in the Database

Ribulose bisphosphate carboxylase large chain

State in the Current Structure

Other States of the Same Protein in the Database

Ribulose bisphosphate carboxylase small subunit

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9fwv__assembly_1__model_1

9fwv__assembly_1__model_1 | I(q)

9fwv__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)

Rubisco in native beta-carboxysomes

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carboxysome assembly protein CcmM

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribulose bisphosphate carboxylase large chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribulose bisphosphate carboxylase small subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9fwv__assembly_1__model_1

9fwv__assembly_1__model_1 | I(q)

9fwv__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)