9g3y

Structure of the Native CMG-decorated gamma-Tubulin Ring Complex from Pig Brain

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gamma-tubulin complex component

Sus scrofa

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Gamma-tubulin complex component 3 × 5 （F1RN46） Gamma-tubulin complex component × 2 （A0A8D1V2H0） Gamma-tubulin complex component × 1 （I3L738） Tubulin gamma complex associated protein 6 × 1 （A0A8W4FDV6） Mitotic spindle organizing protein 1 × 3 （A0A4X1VBW8） Mitotic-spindle organizing protein 2A isoform X4 × 4 （F1RK97） Tubulin gamma chain × 14 （A0A287BRH5） CDK5 regulatory subunit-associated protein 2 × 10 （A0A0A0MRG9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8D1IGH3_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–905； UniProt 1–905 Author chain C； PDBConstruct 1–905； UniProt 1–905 Author chain E； PDBConstruct 1–905； UniProt 1–905 Author chain G； PDBConstruct 1–905； UniProt 1–905 Author chain M； PDBConstruct 1–905； UniProt 1–905

Gamma-tubulin complex component 3

Sus scrofa

UniProt F1RN46

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Gamma-tubulin complex component × 5 （A0A8D1IGH3） Gamma-tubulin complex component × 2 （A0A8D1V2H0） Gamma-tubulin complex component × 1 （I3L738） Tubulin gamma complex associated protein 6 × 1 （A0A8W4FDV6） Mitotic spindle organizing protein 1 × 3 （A0A4X1VBW8） Mitotic-spindle organizing protein 2A isoform X4 × 4 （F1RK97） Tubulin gamma chain × 14 （A0A287BRH5） CDK5 regulatory subunit-associated protein 2 × 10 （A0A0A0MRG9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RN46_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–910； UniProt 1–910 Author chain D； PDBConstruct 1–910； UniProt 1–910 Author chain F； PDBConstruct 1–910； UniProt 1–910 Author chain H； PDBConstruct 1–910； UniProt 1–910 Author chain N； PDBConstruct 1–910； UniProt 1–910

Gamma-tubulin complex component

Sus scrofa

UniProt A0A8D1V2H0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Gamma-tubulin complex component × 5 （A0A8D1IGH3） Gamma-tubulin complex component 3 × 5 （F1RN46） Gamma-tubulin complex component × 1 （I3L738） Tubulin gamma complex associated protein 6 × 1 （A0A8W4FDV6） Mitotic spindle organizing protein 1 × 3 （A0A4X1VBW8） Mitotic-spindle organizing protein 2A isoform X4 × 4 （F1RK97） Tubulin gamma chain × 14 （A0A287BRH5） CDK5 regulatory subunit-associated protein 2 × 10 （A0A0A0MRG9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8D1V2H0_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain I； PDBConstruct 1–667； UniProt 1–667 Author chain K； PDBConstruct 1–667； UniProt 1–667

Gamma-tubulin complex component

Sus scrofa

UniProt I3L738

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Gamma-tubulin complex component × 5 （A0A8D1IGH3） Gamma-tubulin complex component 3 × 5 （F1RN46） Gamma-tubulin complex component × 2 （A0A8D1V2H0） Tubulin gamma complex associated protein 6 × 1 （A0A8W4FDV6） Mitotic spindle organizing protein 1 × 3 （A0A4X1VBW8） Mitotic-spindle organizing protein 2A isoform X4 × 4 （F1RK97） Tubulin gamma chain × 14 （A0A287BRH5） CDK5 regulatory subunit-associated protein 2 × 10 （A0A0A0MRG9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3L738_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain J； PDBConstruct 1–1061； UniProt 1–1061

Tubulin gamma complex associated protein 6

Sus scrofa

UniProt A0A8W4FDV6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Gamma-tubulin complex component × 5 （A0A8D1IGH3） Gamma-tubulin complex component 3 × 5 （F1RN46） Gamma-tubulin complex component × 2 （A0A8D1V2H0） Gamma-tubulin complex component × 1 （I3L738） Mitotic spindle organizing protein 1 × 3 （A0A4X1VBW8） Mitotic-spindle organizing protein 2A isoform X4 × 4 （F1RK97） Tubulin gamma chain × 14 （A0A287BRH5） CDK5 regulatory subunit-associated protein 2 × 10 （A0A0A0MRG9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8W4FDV6_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain L； PDBConstruct 1–1715； UniProt 1–1715

Mitotic spindle organizing protein 1

Sus scrofa

UniProt A0A4X1VBW8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Gamma-tubulin complex component × 5 （A0A8D1IGH3） Gamma-tubulin complex component 3 × 5 （F1RN46） Gamma-tubulin complex component × 2 （A0A8D1V2H0） Gamma-tubulin complex component × 1 （I3L738） Tubulin gamma complex associated protein 6 × 1 （A0A8W4FDV6） Mitotic-spindle organizing protein 2A isoform X4 × 4 （F1RK97） Tubulin gamma chain × 14 （A0A287BRH5） CDK5 regulatory subunit-associated protein 2 × 10 （A0A0A0MRG9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VBW8_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain O； PDBConstruct 1–79； UniProt 1–79 Author chain P； PDBConstruct 1–79； UniProt 1–79 Author chain Q； PDBConstruct 1–79； UniProt 1–79

Mitotic-spindle organizing protein 2A isoform X4

Sus scrofa

UniProt F1RK97

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Gamma-tubulin complex component × 5 （A0A8D1IGH3） Gamma-tubulin complex component 3 × 5 （F1RN46） Gamma-tubulin complex component × 2 （A0A8D1V2H0） Gamma-tubulin complex component × 1 （I3L738） Tubulin gamma complex associated protein 6 × 1 （A0A8W4FDV6） Mitotic spindle organizing protein 1 × 3 （A0A4X1VBW8） Tubulin gamma chain × 14 （A0A287BRH5） CDK5 regulatory subunit-associated protein 2 × 10 （A0A0A0MRG9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RK97_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain V； PDBConstruct 1–155； UniProt 1–155 Author chain W； PDBConstruct 1–155； UniProt 1–155 Author chain X； PDBConstruct 1–155； UniProt 1–155 Author chain Y； PDBConstruct 1–155； UniProt 1–155

Tubulin gamma chain

Sus scrofa

UniProt A0A287BRH5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Gamma-tubulin complex component × 5 （A0A8D1IGH3） Gamma-tubulin complex component 3 × 5 （F1RN46） Gamma-tubulin complex component × 2 （A0A8D1V2H0） Gamma-tubulin complex component × 1 （I3L738） Tubulin gamma complex associated protein 6 × 1 （A0A8W4FDV6） Mitotic spindle organizing protein 1 × 3 （A0A4X1VBW8） Mitotic-spindle organizing protein 2A isoform X4 × 4 （F1RK97） CDK5 regulatory subunit-associated protein 2 × 10 （A0A0A0MRG9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287BRH5_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain a； PDBConstruct 1–451； UniProt 1–451 Author chain b； PDBConstruct 1–451； UniProt 1–451 Author chain c； PDBConstruct 1–451； UniProt 1–451 Author chain d； PDBConstruct 1–451； UniProt 1–451 Author chain e； PDBConstruct 1–451； UniProt 1–451 Author chain f； PDBConstruct 1–451； UniProt 1–451 Author chain g； PDBConstruct 1–451； UniProt 1–451 Author chain h； PDBConstruct 1–451； UniProt 1–451 Author chain i； PDBConstruct 1–451； UniProt 1–451 Author chain j； PDBConstruct 1–451； UniProt 1–451 Author chain k； PDBConstruct 1–451； UniProt 1–451 Author chain l； PDBConstruct 1–451； UniProt 1–451 Author chain m； PDBConstruct 1–451； UniProt 1–451 Author chain n； PDBConstruct 1–451； UniProt 1–451

CDK5 regulatory subunit-associated protein 2

Homo sapiens

UniProt A0A0A0MRG9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Gamma-tubulin complex component × 5 （A0A8D1IGH3） Gamma-tubulin complex component 3 × 5 （F1RN46） Gamma-tubulin complex component × 2 （A0A8D1V2H0） Gamma-tubulin complex component × 1 （I3L738） Tubulin gamma complex associated protein 6 × 1 （A0A8W4FDV6） Mitotic spindle organizing protein 1 × 3 （A0A4X1VBW8） Mitotic-spindle organizing protein 2A isoform X4 × 4 （F1RK97） Tubulin gamma chain × 14 （A0A287BRH5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0A0MRG9_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain o； PDBConstruct 1–1663； UniProt 1–1663 Author chain p； PDBConstruct 1–1663； UniProt 1–1663 Author chain q； PDBConstruct 1–1663； UniProt 1–1663 Author chain r； PDBConstruct 1–1663； UniProt 1–1663 Author chain s； PDBConstruct 1–1663； UniProt 1–1663 Author chain t； PDBConstruct 1–1663； UniProt 1–1663 Author chain u； PDBConstruct 1–1663； UniProt 1–1663 Author chain v； PDBConstruct 1–1663； UniProt 1–1663 Author chain w； PDBConstruct 1–1663； UniProt 1–1663 Author chain x； PDBConstruct 1–1663； UniProt 1–1663

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9g3y
Deposition date deposition_date	2024-07-12
Structure title title	Structure of the Native CMG-decorated gamma-Tubulin Ring Complex from Pig Brain
Keywords keywords	Tubulin Complex, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9g3y__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9g3y__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9g3y__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	112.50 Å
Total Rg	112.50 Å
Atom count	118940
Residues	16637
Excluded volume	1329300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9g3y__assembly_1__model_1`	45-meric （45）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Gamma-tubulin complex component
Molecular weight formula_weight	102609.7 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,M
Atom count atom_count	118940

MSEFRIHHDVNELLSLLRVHGGDGAEVYIDLLQKNRTPYVTTTVSAHSAKVKIAEFSRTPEDFLKKYDELKSKNTRNLDPLVYLLSKLMEDRETLQYLQQNAKERAELAASAAASSTASFGASATASKISMQELEELRKQLGSVATGPTWQQSLELTRKMLRDKQSKKNSGQRLPVLPAWVYERPALLGDFLPGTGGSADTAVPIGSLPLASQEAAVVEDLLYVLVGVDGRYISAQPLTGRQGRTFLVDPNLDLSIRELVSRILPVAASYSTVTRFIEEKSSFEYGQVNHALAAAMRTLVKEYLVLVTQLEQLQRQGLLSLQKLWFYIQPAMRSLDILASLATSVDKGECIGGATLSLLHDRSFSYTGDSQAQELCLHLTKAASTPYFEILEKWIYRGIIDDPYSEFMVEEHELRKEKIQEDYNDKYWDQRYTVVQRQIPSFLQKMAGKVLSTGKYLNVVRECGHDVTCPVAKEVVYTLKERAYVEQIEKAFSYASKVLLDFLMGEKELLAHLRSIKRYFLMDQGDFFVHFMDLTEEELKKPVDDITPTRLEALLELALRMSTANTDPFKDDLKIDLMPHDLITQLLRVLAIETQQEKAMVHADPTELTLSGLEAFSFDYVVTWPLSLIINRKALTRYQMLFRHMFYCKHVERQLCSVWISNKAAKRFSLHSAKWFAGAFTLRQRMLNFVQNIQSYMMFEVMEPTWHVLEQNLRSASNIDDVLGHHASFLDNCLKDCMLTNPELLRVFSKLMSVCVMFTNCLQRFTQSMKLDSELGHPALEPGAMLGPPTEAERAEERARKELARKCLAEHVDAPQLASSFEATITKFDKNFSAHLLDLLARLSIYSTSDCEHGMASVISRLDFNGFYTERLERLSAERSQKAAPPVPGPRGPPALVPRVAVTAQ

Source Source

Source organism organism	Sus scrofa
Common name common_name	pig
NCBI taxonomy ID ncbi_taxonomy_id	9823
Host organism host_organism	Sus scrofa

Entity 2 Entity 2 polymer

Description description	Gamma-tubulin complex component 3
Molecular weight formula_weight	103172.5 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,N

MATPDQKSPNVLLQNLCCRILGKSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELTRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRKQPSKVSGYAALFAQALPRDAHSTPYYYARPQSLPLNYQERGAPSAQSAGSAGSSGVSSLGTYALNGPTPPPPPPALLPGQPLPAPGVGDGLRQQLGSRLAWTLTASQPSLPSTTSKAVPSSGSRGAARPRREGDAAAGAVEVTEAALVRDILYVFQGIDGKHVKMSNADNCYTVEGKANLSKSLRDTAVRLAELGWLHNKIRKYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKMRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYARSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPAVKADRLWHDKYALRKPMIPSFMTMDQCRKVLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQFDSPEILKRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHYLRAFNFLWRAKRVEYILTDIRKGHMCNARLLRSMPEFSGVLHHCHILASEMVHFIHQMQYYVTFEVLECSWDELWNRVQRAQDLDHIIAAHEAFLGTVISRCLLDSDSRALLNQLRAVFDQIIELQNTQDAIYRAALEELQRRLQFEEKKKQREAEGQWGVSAAEEEQEKRRVQEFQESIPKMCSQLRILTHFYQGVVQQFLVSLTTSSDESLRFLSFRLDFNEHYRAREPRLRVSLGTRGRRSSHT

Source Source

Source organism organism	Sus scrofa
Common name common_name	pig
NCBI taxonomy ID ncbi_taxonomy_id	9823
Host organism host_organism	Sus scrofa

Entity 3 Entity 3 polymer

Description description	Gamma-tubulin complex component
Molecular weight formula_weight	76104.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,K

MIHELLLALSGYPGSIFTWNKRGGLQVSQDFPFLHPSETSVLNRLCRLGTDYIRFTEFIEQYTGHVQQQDHHPSQQGQGGLHGIYLRAFCTGLDSVLQPYRQALLDLEQEFLADPHLSISHINYSLDQFQLLFPSVMVVVEQIKSQKIHGCQILETVYKHSCGGLPPVRSALEKILAVCHGVMYKQLSAWMLHGLLLDQHEEFFIKQGPSSGNVSAQPEEDEEDLGIGGLTGKQLRELQDLRLIEEENMLAPSLKQFSLRVEILPSYIPVRVAEKILFVGESVQMFENQNVNLTRKGSILKDQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDLLGQLKIIKDFYLLGRGELFQAFIDTAQHMLKTPPTAVTEHDVNVAFQQSAHKVLLDDDNLLPLLHLTIEYHGKEHKADATQAREGPSRETSPREAPASGWAALGLSYKVQWPLHILFTPAVLEKYNVVFKYLLSVRRVQAELQHCWALQMQRKHLKSNQTDAVKWRLRNHMAFLVDNLQYYLQVDVLESQFSQLLHQINSTRDFESIRLAHDHFLSNLLAQSFILLKPVFHCLNEILDLCHSFCSLVSQNLGPLDERGAAQLSILVKGFSRQSSLLFKILSSVRNHQINSDLAQLLLRLDYNKYYTQAGGTLGSFGM

Source Source

Source organism organism	Sus scrofa
Common name common_name	pig
NCBI taxonomy ID ncbi_taxonomy_id	9823
Host organism host_organism	Sus scrofa

Entity 4 Entity 4 polymer

Description description	Gamma-tubulin complex component
Molecular weight formula_weight	122040.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MASPAPSWTRLDPQQERDVRELIRLVSGVQDEADPNFQLALHFAWSNFRFHRFLDVNSHKVEKTIEGIYEKFIIHSDLSKAASWKRLTDEFLNASLPSIKEIKTDAHYSILSLLLCLSDSPSNSNYVETPRNKEVEKKDDFDWGKYLMEGEEIDLGPNVDTPNWSEESEDEDDPQPLSREDSGIQVDRTPLEEQDQSRKPASRVSWKVDEPDARSWLEQHVVRQYWTTRSSKFPHSLHLHSNLAAVWDQHLYSSDPLYVPDDRVSVTETQVIRETLWLLSGVKKLFIFQLIDGKVAVRNNIMVTHLTHSCLRSVLEQIAAYGQVVFRLQEFIDEVMGHSSESTLPGNGSVPKKSTDAPFRTYQAFMWALYKYFISFKEELSEIEKCIINNDTTVTLAIVVDKLSPRLAQLKVLHKVFSTGVAEVPPDTRNVVRASHLLNTLYKAILEYDNVGEASEQTVSLLFSLWVETVRPYLQIVDEWIVHGHLCDGAREFIIQRNKNVPVNHRDFWYATYTLYSVSEKTENEEKMSDNASASSGSDQGPSSRQHTMVSFLKPVLKQIIMAGKSMQLLKNLQCAESTTCQAMARDAERKSLYTLFLESVQSRLRHGEDATAQALTEQQATRETLIKMQSIAERHLELDDVHDPLLAINFARLYLEQSDFHEKFAGGDICVDRSSESVTCQTFELTLRSCLYPHIDKQYLDCCGNLMRTLKKDYRLVEYLQAMRNFFLMEGGDTMYDFYTSIFDKIREKETWQNVSFLNVQLQEAVGQRYPEDSSRLSISFENTDTAKKKLPVHTLDGLTLSYKVPWPVDIVISLECQKIYNQVFLLLLQIKWAKYSLDVLLFGELASSAEKPQSKEGLLSGQDTAAQFGPQKEPVRQQIHRMFLLRVKLMHFVNSLHNYIMTRILHSTGLEFQHQVEEAKDLDQLIKIHYRYLSTIHDRCLLREKVSFVKEAIMKVLNLALMFADGWQAGLGAWQMESIEKMESDFKNCHMFLVTILNKAVCRGSFPHLESLALSLMAGMEQKREDDLFNHTWGQGDLPNYTCAVRLLGVRKGGGTRPK

Source Source

Source organism organism	Sus scrofa
Common name common_name	pig
NCBI taxonomy ID ncbi_taxonomy_id	9823
Host organism host_organism	Sus scrofa

Entity 5 Entity 5 polymer

Description description	Tubulin gamma complex associated protein 6
Molecular weight formula_weight	188644.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MASVPQLLDDLCEALLPAAKAHLGQRRGSRKRAKQSLKKVAYNALFTNLFQDEARKLQPDLPRLPVKNRILMLSFDLRVGGLAAEADRLEELVEGLETAPRGPLAELGSVLDLLVQLAGSGPPRVLQRRRDYFLPKEHVGRNVRYGGYDCCHLSGIEADVRSIISGEEELCRDLIRKTLQVMEAAPGTGLPAFGLSSYGDPYGDRFERDTRVSLFGALVHSRTADLDVRLDLPPVPDSADVSGLAIKVPLSVDQSEDEGFQSAPNLTPDSQSEPGVTPDIDLWEAVLTYEASRRRCWEQIGCPPGHREEPYLTEAGRDAFDRFCRLRQGELQVLGGALLQAPQPVLVKESELVKDTLNVLLGVVSATFSLCQPAQAFTVKRGVHVSGASPESVSSLLSEVAECGTHYARLSDFSLQPVLDSSCSKGLVFQAFTSGLRRYLQYYRACVLSTPPTLSLLTIGFLFKKLGRQLRYLAELCGVGTALPGTGGGEPRAAFPTGVRLLSYLYQEALDNCSNEHYPVLLSLLKTSCEPYTRFIHDWVYSGVFRDVYGEFMIQVNHEYLGCRDKSYWTHGYVLVSKEVEACVPVFLKHVAHDVYVCGKTINLLKLCCPRHYLCCSDVPVPRISVIFSLEELKDIEKDCAIYVGRMERVARHSSLSKEEKELRMEIAKQELIVHAREAASRVLSALSDRQMSERMALDARKREQFQRLKEQFMRDQERRRAARQEELDDDFSYARELRDRERRLKALEEQLERKARQALVDHYSKLSAEAARRERKALWRVQRHRLADARRRFLLEEEKRVQVMPSCSWERNQGALVFQASLPCPEHPDGGGGCGSGPSEQPKAARDGPRGPSRLMPQLPESPAEAACGLLSVGLSIRDFLPTAQGAEQPLHTGSALVLEEALQTIGSDLPPPAPSAAVGTGPSGPQEYDFRTILRPAVATSAFPGPLQSTGGGLGSEGQPQWEDTHVQLDMCVLDGQVALPHACSPQKTSPQEGSQAMGQLLRQVSEGDVPTGGYASGTAPSRPRWNVHGHVSDASIKVGENVCDVVPSRPRWNVHGHVSDASIKVGENVCDVVPSRPRWNVHGHVSDASIKVGENVCDVVPSRPRWNIHGHVSDASIKVGENVCDVVPSRPRWNVHGHVSQSQVTLGVLSGEAEPIVPWPHQTPPDHGSQSGLSLGAQSPAQEGEPQPAAETAVEGAESGPQASPTAGAGSSLLSGSRLGPEARPPPPPPHLFCPGRSEDTVDLPASCRPSSQVRGQGLGVGGESSAGCPSHPACPFMGNEGSVPGPGVDTQSSPGLGEEAAQRWGMEQAYLAGLAGQYRLEQYPDSYEAMSEPPVARLLHHGLPRAFALPEDSGVQPDTDETAVQLSELLPLPVLMKHSVTAPLAAHVSLVNKAAVDYFFVELHLGAHFEALRHFLLMEDGEFAQSLSDLLFEKLGAGQTPGELLSPLVLNSVLSKALQYSLHGDTPHAANLSFALKFLPEAFAPNAPDVLSCLELRYKVDWPLNIVVTEGCLSRYSGIFSFLLQLKLMMWTLKDVCFHLKRTARMSHVASSVQFRQLQLFKHEMQHFVKVIQGYIANQILHVTWCEFRARLASVGDLEEIQRAHAEYLHKAVFRGLLTEKAAPAMNIIHSLFSLVLKFRSQLISQPWGLAGGPHGAEHPNFALMQQSYSTFKYYSHFLFKVVSKLVNRGYQPHLEDFLLRINFNNYYQDA

Source Source

Source organism organism	Sus scrofa
Common name common_name	pig
NCBI taxonomy ID ncbi_taxonomy_id	9823
Host organism host_organism	Sus scrofa

Entity 6 Entity 6 polymer

Description description	Mitotic spindle organizing protein 1
Molecular weight formula_weight	8285.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,Q,O

MAGNSGSGAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAAENMTS

Source Source

Source organism organism	Sus scrofa
Common name common_name	pig
NCBI taxonomy ID ncbi_taxonomy_id	9823
Host organism host_organism	Sus scrofa

Entity 7 Entity 7 polymer

Description description	Mitotic-spindle organizing protein 2A isoform X4
Molecular weight formula_weight	15920.3 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,W,X,Y

MAAPGAGPGPGAPPGLEAALQKLALRRKKVLSAEETELFELAQAAGGAMDPEVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPVAVPLPTTSVPETRGRNRGSSALGGGPALAERSGREGSSQRMPRQPSATRLPKGGGPGKSPTRST

Source Source

Source organism organism	Sus scrofa
Common name common_name	pig
NCBI taxonomy ID ncbi_taxonomy_id	9823
Host organism host_organism	Sus scrofa

Entity 8 Entity 8 polymer

Description description	Tubulin gamma chain
Molecular weight formula_weight	51135.6 kDa
Source method src_method	man
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h,i,j,k,l,m,n

MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQYDKLRKREAFLEQFRKEDIFKENFDELDRSREVVQELIDEYHAATRPDYISWGTQEQ

Source Source

Source organism organism	Sus scrofa
Common name common_name	pig
NCBI taxonomy ID ncbi_taxonomy_id	9823
Host organism host_organism	Sus scrofa

Entity 9 Entity 9 polymer

Description description	CDK5 regulatory subunit-associated protein 2
Molecular weight formula_weight	189905.8 kDa
Source method src_method	man
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o,q,r,s,t,v,u,w,x,p

MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERMQQEFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEKAFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEKERETEAAQMEHQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQTQEFQGSEDYETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIRDLRNEVEKLRNEVNEREKAMENRYKSLLSESNKKLHNQEQVIKHLTESTNQKDVLLQKFNEKDLEVIQQNCYLMAAEDLELRSEGLITEKCSSQQPPGSKTIFSKEKKQSSDYEELIQVLKKEQDIYTHLVKSLQESDSINNLQAELNKIFALRKQLEQDVLSYQNLRKTLEEQISEIRRREESFSLYSDQTSYLSICLEENNRFQVEHFSQEELKKKVSDLIQLVKELYTDNQHLKKTIFDLSCMGFQGNGFPDRLASTEQTEEAKKSRLPILIKPSRSLGNMYRLPATQEVVTQLQSQILELQGELKEFKTCNKQLHQKLILAEAVMEGRPTPDKTLLNAQPPVGAAYQDSPGEQKGIKTTSSVWRDKEMDSDQQRSYEIDSEICPPDDLASLPSCKENPEDVLSPTSVATYLSSKSQPSAKVSVMGTDQSESINTSNETEYLKQKIHDLETELEGYQNFIFQLQKHSQCSEAIITVLCGTEGAQDGLSKPKNGSDGEEMTFSSLHQVRYVKHVKILGPLAPEMIDSRVLENLKQQLEEQEYKLQKEQNLNMQLFSEIHNLQNKFRDLSPPRYDSLVQSQARELSLQRQQIKDGHGICVISRQHMNTMIKAFEELLQASDVDYCVAEGFQEQLNQCAELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMVNSFSQDLLMEHIQEIRTLRKRLEESIKTNEKLRKQLERQGSEFVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQKENDKLRESLSRKTVSLEHLQREYASVKEENERLQKEGSEKERHNQQLIQEVRCSGQELSRVQEEVKLRQQLLSQNDKLLQSLRVELKAYEKLDEEHRRLREASGEGWKGQDPFRDLHSLLMEIQALRLQLERSIETSSTLQSRLKEQLARGAEKAQEGALTLAVQAVSIPEVPLQPDKHDGDKYPMESDNSFDLFDSSQAVTPKSVSETPPLSGNDTDSLSCDSGSSATSTPCVSRLVTGHHLWASKNGRHVLGLIEDYEALLKQISQGQRLLAEMDIQTQEAPSSTSQELGTKGPHPAPLSKFVSSVSTAKLTLEEAYRRLKLLWRVSLPEDGQCPLHCEQIGEMKAEVTKLHKKLFEQEKKLQNTMKLLQLSKRQEKVIFDQLVVTHKILRKARGNLELRPGGAHPGTCSPSRPGS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	6.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	16448

Structure of the Native CMG-decorated gamma-Tubulin Ring Complex from Pig Brain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gamma-tubulin complex component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Gamma-tubulin complex component 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Gamma-tubulin complex component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Gamma-tubulin complex component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin gamma complex associated protein 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitotic spindle organizing protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitotic-spindle organizing protein 2A isoform X4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin gamma chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CDK5 regulatory subunit-associated protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9g3y__assembly_1__model_1

9g3y__assembly_1__model_1 | I(q)

9g3y__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment