SAXSdb — 9g40

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gamma-tubulin complex component 3

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Gamma-tubulin complex component × 1 （A0A480VJI0） Mitotic-spindle organizing protein 2A isoform X4 × 1 （F1RK97） CDK5 regulatory subunit-associated protein 2 × 2 （Q96SN8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RN46_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain F； PDBConstruct 1–910； UniProt 1–910

Gamma-tubulin complex component

OrganismNot specified

UniProt A0A480VJI0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Gamma-tubulin complex component 3 × 1 （F1RN46） Mitotic-spindle organizing protein 2A isoform X4 × 1 （F1RK97） CDK5 regulatory subunit-associated protein 2 × 2 （Q96SN8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A480VJI0_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–905； UniProt 1–905

Mitotic-spindle organizing protein 2A isoform X4

OrganismNot specified

UniProt F1RK97

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Gamma-tubulin complex component 3 × 1 （F1RN46） Gamma-tubulin complex component × 1 （A0A480VJI0） CDK5 regulatory subunit-associated protein 2 × 2 （Q96SN8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RK97_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain X； PDBConstruct 1–155； UniProt 1–155

CDK5 regulatory subunit-associated protein 2

Homo sapiens

UniProt Q96SN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Gamma-tubulin complex component 3 × 1 （F1RN46） Gamma-tubulin complex component × 1 （A0A480VJI0） Mitotic-spindle organizing protein 2A isoform X4 × 1 （F1RK97）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CK5P2_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain u； PDBConstruct 1–1893； UniProt 1–1893 Author chain v； PDBConstruct 1–1893； UniProt 1–1893

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9g40
Deposition date deposition_date	2024-07-12
Structure title title	Structure of the Position 7 CMG-decorated gamma-Tubulin Ring Complex from Pig Brain
Keywords keywords	Tubulin Complex, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9g40__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9g40__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9g40__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	45.36 Å
Rg (electron density)	45.52 Å
Total Rg	45.60 Å
Atom count	24900
Residues	1527
Excluded volume	222360 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9g40__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Gamma-tubulin complex component 3
Molecular weight formula_weight	103172.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F
Atom count atom_count	24900

MATPDQKSPNVLLQNLCCRILGKSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELTRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRKQPSKVSGYAALFAQALPRDAHSTPYYYARPQSLPLNYQERGAPSAQSAGSAGSSGVSSLGTYALNGPTPPPPPPALLPGQPLPAPGVGDGLRQQLGSRLAWTLTASQPSLPSTTSKAVPSSGSRGAARPRREGDAAAGAVEVTEAALVRDILYVFQGIDGKHVKMSNADNCYTVEGKANLSKSLRDTAVRLAELGWLHNKIRKYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKMRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYARSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPAVKADRLWHDKYALRKPMIPSFMTMDQCRKVLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQFDSPEILKRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHYLRAFNFLWRAKRVEYILTDIRKGHMCNARLLRSMPEFSGVLHHCHILASEMVHFIHQMQYYVTFEVLECSWDELWNRVQRAQDLDHIIAAHEAFLGTVISRCLLDSDSRALLNQLRAVFDQIIELQNTQDAIYRAALEELQRRLQFEEKKKQREAEGQWGVSAAEEEQEKRRVQEFQESIPKMCSQLRILTHFYQGVVQQFLVSLTTSSDESLRFLSFRLDFNEHYRAREPRLRVSLGTRGRRSSHT

Entity 2 Entity 2 polymer

Description description	Gamma-tubulin complex component
Molecular weight formula_weight	102609.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSEFRIHHDVNELLSLLRVHGGDGAEVYIDLLQKNRTPYVTTTVSAHSAKVKIAEFSRTPEDFLKKYDELKSKNTRNLDPLVYLLSKLMEDRETLQYLQQNAKERAELAASAAASSTASFGASATASKISMQELEELRKQLGSVATGPTWQQSLELTRKMLRDKQSKKNSGQRLPVLPAWVYERPALLGDFLPGTGGSADTAVPIGSLPLASQEAAVVEDLLYVLVGVDGRYISAQPLTGRQGRTFLVDPNLDLSIRELVSRILPVAASYSTVTRFIEEKSSFEYGQVNHALAAAMRTLVKEYLVLVTQLEQLQRQGLLSLQKLWFYIQPAMRSLDILASLATSVDKGECIGGATLSLLHDRSFSYTGDSQAQELCLHLTKAASTPYFEILEKWIYRGIIDDPYSEFMVEEHELRKEKIQEDYNDKYWDQRYTVVQRQIPSFLQKMAGKVLSTGKYLNVVRECGHDVTCPVAKEVVYTLKERAYVEQIEKAFSYASKVLLDFLMGEKELLAHLRSIKRYFLMDQGDFFVHFMDLTEEELKKPVDDITPTRLEALLELALRMSTANTDPFKDDLKIDLMPHDLITQLLRVLAIETQQEKAMVHADPTELTLSGLEAFSFDYVVTWPLSLIINRKALTRYQMLFRHMFYCKHVERQLCSVWISNKAAKRFSLHSAKWFAGAFTLRQRMLNFVQNIQSYMMFEVMEPTWHVLEQNLRSASNIDDVLGHHASFLDNCLKDCMLTNPELLRVFSKLMSVCVMFTNCLQRFTQSMKLDSELGHPALEPGAMLGPPTEAERAEERARKELARKCLAEHVDAPQLASSFEATITKFDKNFSAHLLDLLARLSIYSTSDCEHGMASVISRLDFNGFYTERLERLSAERSQKAAPPVPGPRGPPALVPRVAVTAQ

Entity 3 Entity 3 polymer

Description description	Mitotic-spindle organizing protein 2A isoform X4
Molecular weight formula_weight	15920.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MAAPGAGPGPGAPPGLEAALQKLALRRKKVLSAEETELFELAQAAGGAMDPEVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPVAVPLPTTSVPETRGRNRGSSALGGGPALAERSGREGSSQRMPRQPSATRLPKGGGPGKSPTRST

Entity 4 Entity 4 polymer

Description description	CDK5 regulatory subunit-associated protein 2
Molecular weight formula_weight	215344.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u,v

MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERMQQEFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEKAFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEKERETEAAQMEHQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQTQEFQGSEDYETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIRDLRNEVEKLRNEVNEREKAMENRYKSLLSESNKKLHNQEQVIKHLTESTNQKDVLLQKFNEKDLEVIQQNCYLMAAEDLELRSEGLITEKCSSQQPPGSKTIFSKEKKQSSDYEELIQVLKKEQDIYTHLVKSLQESDSINNLQAELNKIFALRKQLEQDVLSYQNLRKTLEEQISEIRRREEESFSLYSDQTSYLSICLEENNRFQVEHFSQEELKKKVSDLIQLVKELYTDNQHLKKTIFDLSCMGFQGNGFPDRLASTEQTELLASKEDEDTIKIGEDDEINFLSDQHLQQSNEIMKDLSKGGCKNGYLRHTESKISDCDGAHAPGCLEEGAFINLLAPLFNEKATLLLESRPDLLKVVRELLLGQLFLTEQEVSGEHLDGKTEKTPKQKGELVHFVQTNSFSKPHDELKLSCEAQLVKAGEVPKVGLKDASVQTVATEGDLLRFKHEATREAWEEKPINTALSAEHRPENLHGVPGWQAALLSLPGITNREAKKSRLPILIKPSRSLGNMYRLPATQEVVTQLQSQILELQGELKEFKTCNKQLHQKLILAEAVMEGRPTPDKTLLNAQPPVGAAYQDSPGEQKGIKTTSSVWRDKEMDSDQQRSYEIDSEICPPDDLASLPSCKENPEDVLSPTSVATYLSSKSQPSAKVSVMGTDQSESINTSNETEYLKQKIHDLETELEGYQNFIFQLQKHSQCSEAIITVLCGTEGAQDGLSKPKNGSDGEEMTFSSLHQVRYVKHVKILGPLAPEMIDSRVLENLKQQLEEQEYKLQKEQNLNMQLFSEIHNLQNKFRDLSPPRYDSLVQSQARELSLQRQQIKDGHGICVISRQHMNTMIKAFEELLQASDVDYCVAEGFQEQLNQCAELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMVNSFSQDLLMEHIQEIRTLRKRLEESIKTNEKLRKQLERQGSEFVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQKENDKLRESLSRKTVSLEHLQREYASVKEENERLQKEGSEKERHNQQLIQEVRCSGQELSRVQEEVKLRQQLLSQNDKLLQSLRVELKAYEKLDEEHRRLREASGEGWKGQDPFRDLHSLLMEIQALRLQLERSIETSSTLQSRLKEQLARGAEKAQEGALTLAVQAVSIPEVPLQPDKHDGDKYPMESDNSFDLFDSSQAVTPKSVSETPPLSGNDTDSLSCDSGSSATSTPCVSRLVTGHHLWASKNGRHVLGLIEDYEALLKQISQGQRLLAEMDIQTQEAPSSTSQELGTKGPHPAPLSKFVSSVSTAKLTLEEAYRRLKLLWRVSLPEDGQCPLHCEQIGEMKAEVTKLHKKLFEQEKKLQNTMKLLQLSKRQEKVIFDQLVVTHKILRKARGNLELRPGGAHPGTCSPSRPGS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	93207

Structure of the Position 7 CMG-decorated gamma-Tubulin Ring Complex from Pig Brain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gamma-tubulin complex component 3

State in the Current Structure

Other States of the Same Protein in the Database

Gamma-tubulin complex component

State in the Current Structure

Other States of the Same Protein in the Database

Mitotic-spindle organizing protein 2A isoform X4

State in the Current Structure

Other States of the Same Protein in the Database

CDK5 regulatory subunit-associated protein 2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9g40__assembly_1__model_1

9g40__assembly_1__model_1 | I(q)

9g40__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

Structure of the Position 7 CMG-decorated gamma-Tubulin Ring Complex from Pig Brain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gamma-tubulin complex component 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Gamma-tubulin complex component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitotic-spindle organizing protein 2A isoform X4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CDK5 regulatory subunit-associated protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9g40__assembly_1__model_1

9g40__assembly_1__model_1 | I(q)

9g40__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)