9hzl

High resolution cryo-EM structure of human complex III in mitochondria

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 8

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit Rieske, mitochondrial × 4 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FE2/S2 (INORGANIC) CLUSTER × 2 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 2 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 UBIQUINONE-10 × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR8_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–82； UniProt 1–82 Author chain N； PDBConstruct 1–82； UniProt 1–82

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt P47985

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FE2/S2 (INORGANIC) CLUSTER × 2 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 2 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 UBIQUINONE-10 × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–274； UniProt 1–274 Author chain C； PDBConstruct 1–274； UniProt 1–274 Author chain O； PDBConstruct 1–274； UniProt 1–274 Author chain P； PDBConstruct 1–274； UniProt 1–274

Cytochrome b-c1 complex subunit 9

OrganismNot specified

UniProt Q9UDW1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 4 （P47985） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FE2/S2 (INORGANIC) CLUSTER × 2 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 2 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 UBIQUINONE-10 × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR9_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–63； UniProt 1–63 Author chain Q； PDBConstruct 1–63； UniProt 1–63

Cytochrome b-c1 complex subunit 6, mitochondrial

OrganismNot specified

UniProt P07919

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 4 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FE2/S2 (INORGANIC) CLUSTER × 2 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 2 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 UBIQUINONE-10 × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR6_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–91； UniProt 1–91 Author chain R； PDBConstruct 1–91； UniProt 1–91

Cytochrome b-c1 complex subunit 7

OrganismNot specified

UniProt P14927

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 4 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FE2/S2 (INORGANIC) CLUSTER × 2 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 2 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 UBIQUINONE-10 × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR7_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–111； UniProt 1–111 Author chain S； PDBConstruct 1–111； UniProt 1–111

Cytochrome b-c1 complex subunit 10

OrganismNot specified

UniProt O14957

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 4 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FE2/S2 (INORGANIC) CLUSTER × 2 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 2 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 UBIQUINONE-10 × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR10_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–56； UniProt 1–56 Author chain T； PDBConstruct 1–56； UniProt 1–56

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt P08574

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 4 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FE2/S2 (INORGANIC) CLUSTER × 2 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 2 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 UBIQUINONE-10 × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY1_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–325； UniProt 1–325 Author chain U； PDBConstruct 1–325； UniProt 1–325

Cytochrome b

OrganismNot specified

UniProt P00156

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 4 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FE2/S2 (INORGANIC) CLUSTER × 2 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 2 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 UBIQUINONE-10 × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–380； UniProt 1–380 Author chain V； PDBConstruct 1–380； UniProt 1–380

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt P22695

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 4 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FE2/S2 (INORGANIC) CLUSTER × 2 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 2 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 UBIQUINONE-10 × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR2_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–453； UniProt 1–453 Author chain W； PDBConstruct 1–453； UniProt 1–453

Cytochrome b-c1 complex subunit 1, mitochondrial

OrganismNot specified

UniProt P31930

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 4 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） CARDIOLIPIN × 9 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FE2/S2 (INORGANIC) CLUSTER × 2 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 2 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 UBIQUINONE-10 × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR1_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–480； UniProt 1–480 Author chain Y； PDBConstruct 1–480； UniProt 1–480

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9hzl
Deposition date deposition_date	2025-01-14
Structure title title	High resolution cryo-EM structure of human complex III in mitochondria
Keywords keywords	Human mitochondria, respirasome complex, cytochrome bc1 complex, CoQH2-cytochrome c reductase, complex III, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9hzl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9hzl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9hzl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	56.05 Å
Rg (electron density)	54.76 Å
Total Rg	54.85 Å
Atom count	68729
Residues	4209
Excluded volume	622740 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9hzl__assembly_1__model_1`	22-meric （22）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (19)

Entity 1 Entity 1 polymer

Description description	Cytochrome b-c1 complex subunit 8
Molecular weight formula_weight	9922.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,N
Atom count atom_count	68729

MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK

Entity 2 Entity 2 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	29705.0 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C,O,P

MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAVRRPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG

Entity 3 Entity 3 polymer

Description description	Cytochrome b-c1 complex subunit 9
Molecular weight formula_weight	7320.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,Q

MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Entity 4 Entity 4 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	10753.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,R

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit 7
Molecular weight formula_weight	13554.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,S

MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK

Entity 6 Entity 6 polymer

Description description	Cytochrome b-c1 complex subunit 10
Molecular weight formula_weight	6577.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,T

MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN

Entity 7 Entity 7 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	35469.0 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,U

MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVMLSALGMLAAGGAGLAMALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPPK

Entity 8 Entity 8 polymer

Description description	Cytochrome b
Molecular weight formula_weight	42745.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,V

MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDASTAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLMTLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILILAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFTTILILMPTISLIENKMLKWA

Entity 9 Entity 9 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	48495.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,W

MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL

Entity 10 Entity 10 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	52704.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,Y

MAASVVCRAATAGAQVLLRARRSPALLRTPALRSTATFAQALQFVPETQVSLLDNGLRVASEQSSQPTCTVGVWIDVGSRFETEKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGGIPWTYAEDAVPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVCDRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDASVVREICSKYIYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF

Entity 11 Entity 11 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 12 Entity 12 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 13 Entity 13 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ;
Molecular weight formula_weight	767.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 15 Entity 15 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 16 Entity 16 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 17 Entity 17 non-polymer

Description description	1,2-dioleoyl-sn-glycero-3-phosphoethanolamine
Molecular weight formula_weight	744.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 18 Entity 18 non-polymer

Description description	UBIQUINONE-10
Molecular weight formula_weight	863.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 19 Entity 19 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	790.1 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.52 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	213731

High resolution cryo-EM structure of human complex III in mitochondria

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c1, heme protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer