5xte

Cryo-EM structure of human respiratory complex III (cytochrome bc1 complex)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 8

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR8_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–81； UniProt 2–82 Author chain N； PDBConstruct 1–81； UniProt 2–82

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt P47985

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_HUMAN
Isoform	—
PDB entities	2, 3
Chains and sequence ranges	Author chain B； PDBConstruct 1–57； UniProt 1–57 Author chain O； PDBConstruct 1–57； UniProt 1–57 Author chain C； PDBConstruct 1–196； UniProt 79–274 Author chain P； PDBConstruct 1–196； UniProt 79–274

Cytochrome b-c1 complex subunit 9

OrganismNot specified

UniProt Q9UDW1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR9_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–62； UniProt 2–63 Author chain Q； PDBConstruct 1–62； UniProt 2–63

Cytochrome b-c1 complex subunit 6, mitochondrial

OrganismNot specified

UniProt P07919

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR6_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–75； UniProt 17–91 Author chain R； PDBConstruct 1–75； UniProt 17–91

Cytochrome b-c1 complex subunit 7

OrganismNot specified

UniProt P14927

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR7_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–106； UniProt 6–111 Author chain S； PDBConstruct 1–106； UniProt 6–111

Cytochrome b-c1 complex subunit 10

OrganismNot specified

UniProt O14957

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR10_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–51； UniProt 2–52 Author chain T； PDBConstruct 1–51； UniProt 2–52

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt P08574

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY1_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–241； UniProt 85–325 Author chain U； PDBConstruct 1–241； UniProt 85–325

Cytochrome b

OrganismNot specified

UniProt P00156

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–378； UniProt 2–379 Author chain V； PDBConstruct 1–378； UniProt 2–379

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt P22695

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） CARDIOLIPIN × 9 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR2_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–419； UniProt 35–453 Author chain W； PDBConstruct 1–419； UniProt 35–453

Cytochrome b-c1 complex subunit 1, mitochondrial

OrganismNot specified

UniProt P31930

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） CARDIOLIPIN × 9 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEME C × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 ;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ; × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR1_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–446； UniProt 35–480 Author chain Y； PDBConstruct 1–446； UniProt 35–480

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5xte
Deposition date deposition_date	2017-06-19
Structure title title	Cryo-EM structure of human respiratory complex III (cytochrome bc1 complex)
Keywords keywords	Respiratory, OXIDOREDUCTASE-ELECTRON TRANSPORT complex; OXIDOREDUCTASE/ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5xte__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5xte__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5xte__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.44 Å
Rg (electron density)	54.28 Å
Total Rg	54.38 Å
Atom count	34492
Residues	4222
Excluded volume	619660 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5xte__assembly_1__model_1`	22-meric （22）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	Cytochrome b-c1 complex subunit 8
Molecular weight formula_weight	9791.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,N
Atom count atom_count	34492

GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK

Entity 2 Entity 2 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	5893.8 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,O

MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSG

Entity 3 Entity 3 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	21645.6 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,P

SHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG

Entity 4 Entity 4 polymer

Description description	Cytochrome b-c1 complex subunit 9
Molecular weight formula_weight	7189.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,Q

AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	8990.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,R

EEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Entity 6 Entity 6 polymer

Description description	Cytochrome b-c1 complex subunit 7
Molecular weight formula_weight	13037.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,S

AVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK

Entity 7 Entity 7 polymer

Description description	Cytochrome b-c1 complex subunit 10
Molecular weight formula_weight	5958.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,T

VTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKF

Entity 8 Entity 8 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	27388.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,U

SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPPK

Entity 9 Entity 9 polymer

Description description	Cytochrome b
Molecular weight formula_weight	42543.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,V

TPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDASTAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLMTLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILILAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFTTILILMPTISLIENKMLKW

Entity 10 Entity 10 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	44946.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,W

PQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL

Entity 11 Entity 11 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	49181.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,Y

TATFAQALQFVPETQVSLLDNGLRVASEQSSQPTCTVGVWIDVGSRFETEKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGGIPWTYAEDAVPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVCDRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDASVVREICSKYIYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF

Entity 12 Entity 12 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 13 Entity 13 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	1,2-dioleoyl-sn-glycero-3-phosphoethanolamine
Molecular weight formula_weight	744.0 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 15 Entity 15 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 16 Entity 16 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 17 Entity 17 non-polymer

Description description	;(9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL ;
Molecular weight formula_weight	767.1 kDa
Source method src_method	syn
Copy count entity_count	3

▼

6. Fold Classification (SCOP + CATH) 30 domains

CATH v4.4 (30 domains)

Domain ID domain_id	5xteA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	210 — Cytochrome b-c1 complex subunit 8

Domain ID domain_id	5xteB00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	210 — Cytochrome Bc1 Complex; Chain I
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain I

Domain ID domain_id	5xteC01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	270 — Ubiquinol cytochrome reductase, transmembrane domain

Domain ID domain_id	5xteC02
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	5xteD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	260 — Cytochrome b-c1 complex subunit 9

Domain ID domain_id	5xteE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	20 — Ubiquinol-cytochrome C reductase hinge domain

Domain ID domain_id	5xteF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1090 — Cytochrome Bc1 Complex; Chain F
Homologous superfamily homologous superfamily	10 — Cytochrome b-c1 complex subunit 7

Domain ID domain_id	5xteG00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	220 —

Domain ID domain_id	5xteH01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	5xteH02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	100 — Cytochrome c1, transmembrane anchor, C-terminal

Domain ID domain_id	5xteJ00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	5xteK01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	5xteK02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	5xteL01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	5xteL02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	5xteN00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	210 — Cytochrome b-c1 complex subunit 8

Domain ID domain_id	5xteO00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	210 — Cytochrome Bc1 Complex; Chain I
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain I

Domain ID domain_id	5xteP01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	270 — Ubiquinol cytochrome reductase, transmembrane domain

Domain ID domain_id	5xteP02
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	5xteQ00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	260 — Cytochrome b-c1 complex subunit 9

Domain ID domain_id	5xteR00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	20 — Ubiquinol-cytochrome C reductase hinge domain

Domain ID domain_id	5xteS00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1090 — Cytochrome Bc1 Complex; Chain F
Homologous superfamily homologous superfamily	10 — Cytochrome b-c1 complex subunit 7

Domain ID domain_id	5xteT00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	220 —

Domain ID domain_id	5xteU01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	5xteU02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	100 — Cytochrome c1, transmembrane anchor, C-terminal

Domain ID domain_id	5xteV00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	5xteW01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	5xteW02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	5xteY01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	5xteY02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	167761

Cryo-EM structure of human respiratory complex III (cytochrome bc1 complex)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c1, heme protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer