9cg3

Human kidney respiratory complex III

Method: ELECTRON MICROSCOPY D_max: 176.6 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 8

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 20 PDB declaration: 20-meric（20） Consistent with protein copy count	Chain A； UniProt 1–82 Chain N； UniProt 1–82	Not recorded	Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） FES FE2/S2 (INORGANIC) CLUSTER × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.96 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9CG3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTE Cryo-EM structure of human respiratory complex III (cytochrome bc1 complex) Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain A 2–82（81 aa） Chain N 2–82（81 aa）	Not recorded	CDL CARDIOLIPIN × 9 FES FE2/S2 (INORGANIC) CLUSTER × 2 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain AA 2–82（81 aa） Chain AN 2–82（81 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain AA 2–82（81 aa） Chain AN 2–82（81 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9HZL High resolution cryo-EM structure of human complex III in mitochondria Deposited 2025-01-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain A 1–82（82 aa） Chain N 1–82（82 aa）	Not recorded	CDL CARDIOLIPIN × 9 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 U10 UBIQUINONE-10 × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) LMNG, 0.001 % cardiolipin, 0.001 % GD, 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.52 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	QCR8_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–82； UniProt 1–82 Author chain N； PDBConstruct 1–82； UniProt 1–82

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt P47985

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 20 PDB declaration: 20-meric（20） Consistent with protein copy count	Chain C； UniProt 1–274 Chain P； UniProt 1–274	Not recorded	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） FES FE2/S2 (INORGANIC) CLUSTER × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.96 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9CG3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTE Cryo-EM structure of human respiratory complex III (cytochrome bc1 complex) Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain B 1–57（57 aa） Fragment：UNP RESIDUES 1-57 Chain C 79–274（196 aa） Chain O 1–57（57 aa） Fragment：UNP RESIDUES 1-57 Chain P 79–274（196 aa）	Not recorded	CDL CARDIOLIPIN × 9 FES FE2/S2 (INORGANIC) CLUSTER × 2 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain AB 1–57（57 aa） Fragment：UNP RESIDUES 1-57 Chain AC 79–274（196 aa） Chain AO 1–57（57 aa） Fragment：UNP RESIDUES 1-57 Chain AP 79–274（196 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain AB 1–57（57 aa） Fragment：UNP RESIDUES 1-57 Chain AC 79–274（196 aa） Chain AO 1–57（57 aa） Fragment：UNP RESIDUES 1-57 Chain AP 79–274（196 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9HZL High resolution cryo-EM structure of human complex III in mitochondria Deposited 2025-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain B 1–274（274 aa） Chain C 1–274（274 aa） Chain O 1–274（274 aa） Chain P 1–274（274 aa）	Not recorded	CDL CARDIOLIPIN × 9 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 U10 UBIQUINONE-10 × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) LMNG, 0.001 % cardiolipin, 0.001 % GD, 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.52 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	UCRI_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–274； UniProt 1–274 Author chain P； PDBConstruct 1–274； UniProt 1–274

Cytochrome b-c1 complex subunit 9

OrganismNot specified

UniProt Q9UDW1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 20 PDB declaration: 20-meric（20） Consistent with protein copy count	Chain D； UniProt 1–63 Chain Q； UniProt 1–63	Not recorded	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） FES FE2/S2 (INORGANIC) CLUSTER × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.96 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9CG3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTE Cryo-EM structure of human respiratory complex III (cytochrome bc1 complex) Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain D 2–63（62 aa） Chain Q 2–63（62 aa）	Not recorded	CDL CARDIOLIPIN × 9 FES FE2/S2 (INORGANIC) CLUSTER × 2 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain AD 2–63（62 aa） Chain AQ 2–63（62 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain AD 2–63（62 aa） Chain AQ 2–63（62 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9HZL High resolution cryo-EM structure of human complex III in mitochondria Deposited 2025-01-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain D 1–63（63 aa） Chain Q 1–63（63 aa）	Not recorded	CDL CARDIOLIPIN × 9 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 U10 UBIQUINONE-10 × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) LMNG, 0.001 % cardiolipin, 0.001 % GD, 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.52 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	QCR9_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–63； UniProt 1–63 Author chain Q； PDBConstruct 1–63； UniProt 1–63

Cytochrome b-c1 complex subunit 6, mitochondrial

OrganismNot specified

UniProt P07919

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 20 PDB declaration: 20-meric（20） Consistent with protein copy count	Chain E； UniProt 1–91 Chain R； UniProt 1–91	Not recorded	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） FES FE2/S2 (INORGANIC) CLUSTER × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.96 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9CG3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTE Cryo-EM structure of human respiratory complex III (cytochrome bc1 complex) Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain E 17–91（75 aa） Chain R 17–91（75 aa）	Not recorded	CDL CARDIOLIPIN × 9 FES FE2/S2 (INORGANIC) CLUSTER × 2 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain AE 18–91（74 aa） Fragment：UNP RESIDUES 18-91 Chain AR 18–91（74 aa） Fragment：UNP RESIDUES 18-91	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain AE 18–91（74 aa） Fragment：UNP RESIDUES 18-91 Chain AR 18–91（74 aa） Fragment：UNP RESIDUES 18-91	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9HZL High resolution cryo-EM structure of human complex III in mitochondria Deposited 2025-01-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain E 1–91（91 aa） Chain R 1–91（91 aa）	Not recorded	CDL CARDIOLIPIN × 9 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 U10 UBIQUINONE-10 × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) LMNG, 0.001 % cardiolipin, 0.001 % GD, 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.52 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	QCR6_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–91； UniProt 1–91 Author chain R； PDBConstruct 1–91； UniProt 1–91

Cytochrome b-c1 complex subunit 7

OrganismNot specified

UniProt P14927

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 20 PDB declaration: 20-meric（20） Consistent with protein copy count	Chain F； UniProt 1–111 Chain S； UniProt 1–111	Not recorded	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） FES FE2/S2 (INORGANIC) CLUSTER × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.96 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9CG3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTE Cryo-EM structure of human respiratory complex III (cytochrome bc1 complex) Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain F 6–111（106 aa） Fragment：UNP RESIDUES 6-111 Chain S 6–111（106 aa） Fragment：UNP RESIDUES 6-111	Not recorded	CDL CARDIOLIPIN × 9 FES FE2/S2 (INORGANIC) CLUSTER × 2 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain AF 6–111（106 aa） Fragment：UNP RESIDUES 6-111 Chain AS 6–111（106 aa） Fragment：UNP RESIDUES 6-111	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain AF 6–111（106 aa） Fragment：UNP RESIDUES 6-111 Chain AS 6–111（106 aa） Fragment：UNP RESIDUES 6-111	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9HZL High resolution cryo-EM structure of human complex III in mitochondria Deposited 2025-01-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain F 1–111（111 aa） Chain S 1–111（111 aa）	Not recorded	CDL CARDIOLIPIN × 9 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 U10 UBIQUINONE-10 × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) LMNG, 0.001 % cardiolipin, 0.001 % GD, 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.52 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	QCR7_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–111； UniProt 1–111 Author chain S； PDBConstruct 1–111； UniProt 1–111

Cytochrome b-c1 complex subunit 10

OrganismNot specified

UniProt O14957

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 20 PDB declaration: 20-meric（20） Consistent with protein copy count	Chain G； UniProt 1–56 Chain T； UniProt 1–56	Not recorded	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） FES FE2/S2 (INORGANIC) CLUSTER × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.96 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9CG3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTE Cryo-EM structure of human respiratory complex III (cytochrome bc1 complex) Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain G 2–52（51 aa） Fragment：UNP RESIDUES 2-52 Chain T 2–52（51 aa） Fragment：UNP RESIDUES 2-52	Not recorded	CDL CARDIOLIPIN × 9 FES FE2/S2 (INORGANIC) CLUSTER × 2 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain AG 2–52（51 aa） Fragment：UNP RESIDUES 2-52 Chain AT 2–52（51 aa） Fragment：UNP RESIDUES 2-52	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain AG 2–52（51 aa） Fragment：UNP RESIDUES 2-52 Chain AT 2–52（51 aa） Fragment：UNP RESIDUES 2-52	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9HZL High resolution cryo-EM structure of human complex III in mitochondria Deposited 2025-01-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain G 1–56（56 aa） Chain T 1–56（56 aa）	Not recorded	CDL CARDIOLIPIN × 9 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 U10 UBIQUINONE-10 × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) LMNG, 0.001 % cardiolipin, 0.001 % GD, 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.52 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	QCR10_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–56； UniProt 1–56 Author chain T； PDBConstruct 1–56； UniProt 1–56

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt P08574

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 20 PDB declaration: 20-meric（20） Consistent with protein copy count	Chain H； UniProt 1–325 Chain U； UniProt 1–325	Not recorded	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） FES FE2/S2 (INORGANIC) CLUSTER × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.96 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9CG3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTE Cryo-EM structure of human respiratory complex III (cytochrome bc1 complex) Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain H 85–325（241 aa） Chain U 85–325（241 aa）	Not recorded	CDL CARDIOLIPIN × 9 FES FE2/S2 (INORGANIC) CLUSTER × 2 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain AH 85–325（241 aa） Chain AU 85–325（241 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain AH 85–325（241 aa） Chain AU 85–325（241 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9HZL High resolution cryo-EM structure of human complex III in mitochondria Deposited 2025-01-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain H 1–325（325 aa） Chain U 1–325（325 aa）	Not recorded	CDL CARDIOLIPIN × 9 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 U10 UBIQUINONE-10 × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) LMNG, 0.001 % cardiolipin, 0.001 % GD, 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.52 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CY1_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–325； UniProt 1–325 Author chain U； PDBConstruct 1–325； UniProt 1–325

Cytochrome b

OrganismNot specified

UniProt P00156

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 20 PDB declaration: 20-meric（20） Consistent with protein copy count	Chain J； UniProt 1–380 Chain V； UniProt 1–380	Not recorded	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） FES FE2/S2 (INORGANIC) CLUSTER × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.96 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9CG3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTE Cryo-EM structure of human respiratory complex III (cytochrome bc1 complex) Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain J 2–379（378 aa） Chain V 2–379（378 aa）	Not recorded	CDL CARDIOLIPIN × 9 FES FE2/S2 (INORGANIC) CLUSTER × 2 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain AJ 2–379（378 aa） Fragment：UNP RESIDUES 1-379 Chain AV 2–379（378 aa） Fragment：UNP RESIDUES 1-379	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain AJ 2–379（378 aa） Fragment：UNP RESIDUES 2-479 Chain AV 2–379（378 aa） Fragment：UNP RESIDUES 2-479	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9HZL High resolution cryo-EM structure of human complex III in mitochondria Deposited 2025-01-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain J 1–380（380 aa） Chain V 1–380（380 aa）	Not recorded	CDL CARDIOLIPIN × 9 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 U10 UBIQUINONE-10 × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) LMNG, 0.001 % cardiolipin, 0.001 % GD, 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.52 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CYB_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–380； UniProt 1–380 Author chain V； PDBConstruct 1–380； UniProt 1–380

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt P22695

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 20 PDB declaration: 20-meric（20） Consistent with protein copy count	Chain K； UniProt 1–453 Chain W； UniProt 1–453	Not recorded	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31930） FES FE2/S2 (INORGANIC) CLUSTER × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.96 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9CG3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTE Cryo-EM structure of human respiratory complex III (cytochrome bc1 complex) Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain K 35–453（419 aa） Fragment：UNP RESIDUES 35-453 Chain W 35–453（419 aa） Fragment：UNP RESIDUES 35-453	Not recorded	CDL CARDIOLIPIN × 9 FES FE2/S2 (INORGANIC) CLUSTER × 2 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain AK 35–453（419 aa） Fragment：UNP RESIDUES 35-453 Chain AW 35–453（419 aa） Fragment：UNP RESIDUES 35-453	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain AK 35–453（419 aa） Fragment：UNP RESIDUES 35-453 Chain AW 35–453（419 aa） Fragment：UNP RESIDUES 35-453	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9HZL High resolution cryo-EM structure of human complex III in mitochondria Deposited 2025-01-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain K 1–453（453 aa） Chain W 1–453（453 aa）	Not recorded	CDL CARDIOLIPIN × 9 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 U10 UBIQUINONE-10 × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) LMNG, 0.001 % cardiolipin, 0.001 % GD, 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.52 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	QCR2_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–453； UniProt 1–453 Author chain W； PDBConstruct 1–453； UniProt 1–453

Cytochrome b-c1 complex subunit 1, mitochondrial

OrganismNot specified

UniProt P31930

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 20 PDB declaration: 20-meric（20） Consistent with protein copy count	Chain L； UniProt 1–480 Chain Y； UniProt 1–480	Not recorded	Cytochrome b-c1 complex subunit 8 × 2 （O14949） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P47985） Cytochrome b-c1 complex subunit 9 × 2 （Q9UDW1） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P07919） Cytochrome b-c1 complex subunit 7 × 2 （P14927） Cytochrome b-c1 complex subunit 10 × 2 （O14957） Cytochrome c1, heme protein, mitochondrial × 2 （P08574） Cytochrome b × 2 （P00156） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P22695） FES FE2/S2 (INORGANIC) CLUSTER × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.96 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9CG3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTE Cryo-EM structure of human respiratory complex III (cytochrome bc1 complex) Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain L 35–480（446 aa） Chain Y 35–480（446 aa）	Not recorded	CDL CARDIOLIPIN × 9 FES FE2/S2 (INORGANIC) CLUSTER × 2 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain AL 35–480（446 aa） Chain AY 35–480（446 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain AL 35–480（446 aa） Chain AY 35–480（446 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9HZL High resolution cryo-EM structure of human complex III in mitochondria Deposited 2025-01-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain L 1–480（480 aa） Chain Y 1–480（480 aa）	Not recorded	CDL CARDIOLIPIN × 9 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1 U10 UBIQUINONE-10 × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) LMNG, 0.001 % cardiolipin, 0.001 % GD, 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.52 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	QCR1_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–480； UniProt 1–480 Author chain Y； PDBConstruct 1–480； UniProt 1–480

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9cg3
Deposition date deposition_date	2024-06-28
Structure title title	Human kidney respiratory complex III
Keywords keywords	human, kidney, respiratory complex III, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	54.75 Å
Radius of gyration Rg (electron density) rg_electron	53.83 Å
Forward intensity I(0) i0	2778630000.00
Molecular weight molecular_weight	451770.0 kDa
Excluded volume excluded_volume	568900 Å³
Envelope volume envelope_volume	812200 Å³
Hydration-shell volume shell_volume	122910 Å³
Envelope diameter envelope_diameter	172.5 Å
Shell Rg shell_rg	59.19 Å
Envelope Rg envelope_rg	52.36 Å
Shape Rg shape_rg	53.82 Å
Total Rg total_rg	54.01 Å
Total atoms total_atoms	31844
Residues n_residues	3994
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	176.6 Å
Rg (real space) rg_real	54.60 Å
Rg uncertainty (real space) rg_real_error	1.25 Å
I(0) (real space) i0_real	2.7790e+09
I(0) uncertainty (real space) i0_real_error	4.9530e+07
Rg (reciprocal space) rg_reciprocal	54.86 Å
I(0) (reciprocal space) i0_reciprocal	2780000000.0000
Solution quality estimate total_estimate	0.8852
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	67.0 Å
Skewness Skewness skewness	0.212
Kurtosis Kurtosis kurtosis	-0.553
Angular range angular_range	— – 0.1450 Å⁻¹
Current regularization parameter α current_alpha	0.0001
Highest regularization parameter α highest_alpha	277800000.0000
Real-space data points n_real_points	30
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.911; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.978; Smooth: 0.794

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	Cytochrome b-c1 complex subunit 8
Molecular weight formula_weight	9922.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,N
Atom count atom_count	31844

MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK

Entity 2 Entity 2 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	29705.0 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,P

MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAVRRPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG

Entity 3 Entity 3 polymer

Description description	Cytochrome b-c1 complex subunit 9
Molecular weight formula_weight	7320.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,Q

MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Entity 4 Entity 4 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	10753.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,R

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit 7
Molecular weight formula_weight	13554.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,S

MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK

Entity 6 Entity 6 polymer

Description description	Cytochrome b-c1 complex subunit 10
Molecular weight formula_weight	6577.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,T

MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN

Entity 7 Entity 7 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	35469.0 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,U

MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVMLSALGMLAAGGAGLAMALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPPK

Entity 8 Entity 8 polymer

Description description	Cytochrome b
Molecular weight formula_weight	42745.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,V

MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDASTAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLMTLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILILAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFTTILILMPTISLIENKMLKWA

Entity 9 Entity 9 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	48495.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,W

MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL

Entity 10 Entity 10 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	52704.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,Y

MAASVVCRAATAGAQVLLRARRSPALLRTPALRSTATFAQALQFVPETQVSLLDNGLRVASEQSSQPTCTVGVWIDVGSRFETEKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGGIPWTYAEDAVPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVCDRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDASVVREICSKYIYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF

Entity 11 Entity 11 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 12 Entity 12 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 13 Entity 13 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.96 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	11523

fit	/app/data/saxs_computation/cg/9cg3/9cg3.fit
pddf	/app/data/pr_computation/cg/9cg3/9cg3.pr.out
profile	/app/data/saxs_computation/cg/9cg3/9cg3.dat

Human kidney respiratory complex III

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome c1, heme protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 non-polymer

Entity 12 Entity 12 non-polymer

Entity 13 Entity 13 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)