SAXSdb — 9iy2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Secreted protein ORF2

Hepatitis E virus (strain Pakistan)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Heavy Chain of mAb 8C11 × 1 Light Chain of mAb 8C11 × 1 Heavy Chain of mAb 8H3 × 1 Light Chain of mAb 8H3 × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Heavy Chain of mAb 8C11 × 1 Light Chain of mAb 8C11 × 1 Heavy Chain of mAb 8H3 × 1 Light Chain of mAb 8H3 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPSD_HEVPA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–211； UniProt 394–603 Author chain B； PDBConstruct 2–211； UniProt 394–603

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9iy2
Deposition date deposition_date	2024-07-29
Structure title title	Immune complex of HEV-E2s, nAb 8C11 and nAb 8H3
Keywords keywords	complex, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9iy2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9iy2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9iy2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	45.44 Å
Rg (electron density)	45.87 Å
Total Rg	45.95 Å
Atom count	7718
Residues	1013
Excluded volume	136750 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9iy2__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9iy2__assembly_2__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Secreted protein ORF2
Molecular weight formula_weight	23117.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	15430

MQLFYSRPVVSANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRVVIQDYDNQHEQDRPTPSPAPSRPFSVLRANDVLWLSLTAAEYDQSTYGSSTGPVYVSDSVTLVNVATGAQAVARSLDWTKVTLDGRPLSTIQQHSKTFFVLPLRGKLSFWEAGTTKAGYPYNYNTTASDQLLVENAAGHRVAISTYTTSLGAGPVSISAVAVLAPPPR

Source Source

Source organism organism	Hepatitis E virus (strain Pakistan)
NCBI taxonomy ID ncbi_taxonomy_id	33774
Host organism host_organism	Bacterial expression vector pET-11a

Entity 2 Entity 2 polymer

Description description	Heavy Chain of mAb 8C11
Molecular weight formula_weight	24476.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,D

QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDVKRYSPALKSRLTISKDTSSSQLFLKIASVDTADTATYYCARIKSVITTGDYALDYWGQGTSVAVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCTSKP

Entity 3 Entity 3 polymer

Description description	Light Chain of mAb 8C11
Molecular weight formula_weight	23648.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,C

DIQMTQSPASLSVSVGETVTITCRASEIIYSNLAWYQQKQGKSPQLLVYSATNLAEGVPSRFSGSGSGTQYSLKINSLQSEDFGSYYCQHFWGNPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Entity 4 Entity 4 polymer

Description description	Heavy Chain of mAb 8H3
Molecular weight formula_weight	23599.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,G

QVQLKESGPGLVAPSQSLSITCTVSGFSLIGYGVNWVRQPPEKGLEWLGMIWGDGSTDYNSALKSRLSITKDNSKSQVFLKMNSLQTDDTARYYCAMGVRPDPFDYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSTVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCTS

Entity 5 Entity 5 polymer

Description description	Light Chain of mAb 8H3
Molecular weight formula_weight	24237.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,I

NIMMTQSPSSLAVSAGEKVTMSCKSSQSVLYSSNQKNYLAWYQQKPGQSPKLLIYWASARESGVPDRFTGSGSGTDFTLTINSVQTEDLAVYYCHQYLSSYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

▶

Unit-cell length a length_a	71.465 Å
Unit-cell length b length_b	248.941 Å
Unit-cell length c length_c	76.841 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	94.07 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.476 Å
Low-resolution limit resolution_low	36.651 Å
R factor r_factor	0.2256
R_work r_work	0.2234
R_free r_free	0.2693

Immune complex of HEV-E2s, nAb 8C11 and nAb 8H3

1. Protein Identity and Related Structures Protein Identity & Related Structures

Secreted protein ORF2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9iy2__assembly_1__model_1

9iy2__assembly_1__model_1 | I(q)

9iy2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)

Immune complex of HEV-E2s, nAb 8C11 and nAb 8H3

1. Protein Identity and Related Structures Protein Identity & Related Structures

Secreted protein ORF2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9iy2__assembly_1__model_1

9iy2__assembly_1__model_1 | I(q)

9iy2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)