SAXSdb — 9l1n

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1 glycoprotein

Western equine encephalitis virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Protocadherin-10 × 1 （Q9P2E7） 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9J1K1_WEEV
Isoform	—
PDB entities	1, 2, 3
Chains and sequence ranges	Author chain A； PDBConstruct 1–439； UniProt 798–1236 Author chain D； PDBConstruct 1–439； UniProt 798–1236 Author chain G； PDBConstruct 1–439； UniProt 798–1236 Author chain J； PDBConstruct 1–439； UniProt 798–1236 Author chain B； PDBConstruct 1–416； UniProt 320–735 Author chain E； PDBConstruct 1–416； UniProt 320–735 Author chain H； PDBConstruct 1–416； UniProt 320–735 Author chain K； PDBConstruct 1–416； UniProt 320–735 Author chain C； PDBConstruct 1–150； UniProt 110–259 Author chain F； PDBConstruct 1–150； UniProt 110–259 Author chain I； PDBConstruct 1–150； UniProt 110–259 Author chain L； PDBConstruct 1–150； UniProt 110–259

Protocadherin-10

Homo sapiens

UniProt Q9P2E7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	E1 glycoprotein × 4 （Q9J1K1） E2 glycoprotein × 4 （Q9J1K1） Capsid glycoprotein × 4 （Q9J1K1） 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PCD10_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain M； PDBConstruct 1–95； UniProt 19–113

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9l1n
Deposition date deposition_date	2024-12-15
Structure title title	Structure of Western equine encephalitis virus 71V1658 strain VLP in complex with human PCDH10 EC1
Keywords keywords	Western Equine Encephalitis virus, WEEV, PCDH10, EC1, receptor, complex, glycoprotein, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9l1n__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9l1n__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9l1n__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	66.62 Å
Rg (electron density)	65.83 Å
Total Rg	66.02 Å
Atom count	31688
Residues	4107
Excluded volume	563520 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9l1n__assembly_1__model_1`	13-meric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	E1 glycoprotein
Molecular weight formula_weight	47326.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J
Atom count atom_count	31688

FEHATTVPNVPGIPYKALVERAGYAPLNLEITVVSSELTPSTNKEYVTCKFHTVIPSPQVKCCGSLECKASSKADYTCRVFGGVYPFMWGGAQCFCDSENTQLSEAYVEFAPDCTIDHAVALKVHTAALKVGLRIVYGNTTAHLDTFVNGVTPGSSRDLKVIAGPISAAFSPFDHKVVIRKGLVYNYDFPEYGAMKPGAFGDIQASSLDATDIVARTDIRLLKPSVKNIHVPYTQAVSGYEMWKNNSGRPLQETAPFGCKIEVEPLRASNCAYGHIPISIDIPDAAFVRSSESPTILEVSCTVADCIYSADFGGSLTLQYKADREGHCPVHSHSTTAVLKEATTHVTAVGSITLHFSTSSPQANFIVSLCGKKSTCNAECKPPADHIIGEPHKVDQEFQAAVSKTSWNWLLALFGGASSLIVVGLIVLVCSSMLINTRR

Source Source

Source organism organism	Western equine encephalitis virus
Common name common_name	WEEV
NCBI taxonomy ID ncbi_taxonomy_id	11039
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	E2 glycoprotein
Molecular weight formula_weight	46218.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,H,K

SITDDFTLTSPYLGFCPYCRHSTPCFSPIKIENVWDESDDGSIRIQVSAQFGYNQAGTADVTKFRYMSFDHDHDIKEDSMEKIAISTSGPCRRLGHKGYFLLAQCPPGDSVTVSITSGASENSCTVEKKIRRKFVGREEYLFPPVHGKLVKCHVYDHLKETSAGYITMHRPGPHAYKSYLEEASGEVYIKPPSGKNVTYECKCGDYSTGIVSTRTKMNGCTKAKQCIAYKSDQTKWVFNSPDLIRHTDHSVQGKLHIPFRLTPTVCPVPLAHTPTVTKWFKGITLHLTAMRPTLLTTRKLGLRADATAEWITGSTSRNFSVGREGLEYVWGNHEPVRVWAQESAPGDPHGWPHEIIIHYYHRHPVYTVIVLCGVALAILVGTASSAACIAKARRDCLTPYALAPNATVPTALAVLC

Source Source

Source organism organism	Western equine encephalitis virus
Common name common_name	WEEV
NCBI taxonomy ID ncbi_taxonomy_id	11039
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Capsid glycoprotein
Molecular weight formula_weight	16409.5 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,I,L

KTFPIMLNGQVNGYACVVGGRLMKPLHVEGKIDNEQLAAVKLKKASMYDLEYGDVPQNMKSDTLQYTSDKPPGFYNWHHGAVQYENGRFTVPRGVGGKGDSGRPILDNRGRVVAIVLGGANEGTRTALSVVTWNQKGVTIRDTPEGSEPW

Source Source

Source organism organism	Western equine encephalitis virus
Common name common_name	WEEV
NCBI taxonomy ID ncbi_taxonomy_id	11039
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Protocadherin-10
Molecular weight formula_weight	10866.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

QLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	8

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	516874

Structure of Western equine encephalitis virus 71V1658 strain VLP in complex with human PCDH10 EC1

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1 glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Protocadherin-10

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9l1n__assembly_1__model_1

9l1n__assembly_1__model_1 | I(q)

9l1n__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

7. Citations (1)

Structure of Western equine encephalitis virus 71V1658 strain VLP in complex with human PCDH10 EC1

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1 glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protocadherin-10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9l1n__assembly_1__model_1

9l1n__assembly_1__model_1 | I(q)

9l1n__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

7. Citations (1)