SAXSdb — 9nyg

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

LmuC

Vibrio cholerae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 4 DNA 2	ABC-three component systems C-terminal domain-containing protein × 1 （A0A060KT36） DUF3732 domain-containing protein × 2 （A0A060KSR0） DNA × 1 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A060KYQ4_VIBCL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–178； UniProt 1–178

ABC-three component systems C-terminal domain-containing protein

Vibrio cholerae

UniProt A0A060KT36

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 4 DNA 2	LmuC × 1 （A0A060KYQ4） DUF3732 domain-containing protein × 2 （A0A060KSR0） DNA × 1 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A060KT36_VIBCL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–388； UniProt 1–388

DUF3732 domain-containing protein

Vibrio cholerae

UniProt A0A060KSR0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 4 DNA 2	LmuC × 1 （A0A060KYQ4） ABC-three component systems C-terminal domain-containing protein × 1 （A0A060KT36） DNA × 1 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A060KSR0_VIBCL
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–653； UniProt 1–653 Author chain G； PDBConstruct 1–653； UniProt 1–653

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9nyg
Deposition date deposition_date	2025-03-27
Structure title title	LmuABC-DNA
Keywords keywords	LmuABC-DNA, DNA BINDING PROTEIN-DNA complex; DNA BINDING PROTEIN/DNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9nyg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9nyg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9nyg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.73 Å
Rg (electron density)	41.35 Å
Total Rg	41.43 Å
Atom count	10061
Residues	1197
Excluded volume	177740 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9nyg__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	LmuC
Molecular weight formula_weight	20310.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C
Atom count atom_count	10061

MIKNLEIQMLKPENNLEKEAWEINNPAMCSYMLWIATLAYYQKQKEPIHPSRLFCLFPFILYSDTRNVLLSSKGSLKSYLAKFSNSKAISGDIPLSIHFRIDIQKNKTLDALIVAFDSGLLVIDSDSGLIKPNVSIKPLPNSKLTDTIKELVYCSTKIGRWLSEMTNQDLARDLKVIF

Source Source

Source organism organism	Vibrio cholerae
NCBI taxonomy ID ncbi_taxonomy_id	666
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	ABC-three component systems C-terminal domain-containing protein
Molecular weight formula_weight	44584.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MKDNSTSAVSSWLGYKIQEYRLTQRLLEANNSSCIGFEILDDLEEHTGSTSTFEQDKISTTGRNIVSNHSKDLWKTLSNWMDLIDSGEIDVDNTIFLLFTNKRCHSEVLQLLSTSQATEEASKAFDEILKIVSHPSPSIANYLNNFSKSKTDACRLISKFTYIYGSGSAPHDLRESYKLHRLGALEEHLDEIMYEILGWVSDVLTLAAEKRQPTIVRAKDFGARLGEIESKYRQKTILNYFCNRSSESEDVQNTIKDAPNYIKQLNLINVDDSELEEAAIANLETKDAVVEWTLNGDVQDYSYRYYQRELRRCWGIQKQKIHLDFNGRPETEVGQRLYIECLNNVTRYYLENKKVGDFFAHGTLHSMADKLTIGWHPEFDKKLGDPDA

Source Source

Source organism organism	Vibrio cholerae
NCBI taxonomy ID ncbi_taxonomy_id	666
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	DUF3732 domain-containing protein
Molecular weight formula_weight	74726.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,B

MFFQIEKVVLWSKEAKHKPRVIEFALNKVNLITGSSKSGKSSLIPIIDYCLGSSKCSIPVNTIRDTTAWYGVQIKTKHSRLLIARRDPSNQLSTSNAFFVEAENIEIPQNIEKHNVNIDTVKNRLNEISGVSNISFDFYDTGRIDKKRTSTRDLSAFNYQPQNIIANPNALFYKTDSFEHKSKLVTILPYVLGALSNTDIENQHRIKNLEEEYRKVERRLLKLKRQNEDWLSSAQAYVIKAMELGLVNSDKDIYQLKPERLLNVLKNIATKEIDYSTSAANIKYASEQEAEITKRSRDISNNLAKVKSRLQNINSMNRLANTHSDASRLKRERLSLSKWLLTQNDINSSLFSEPNEIRSLVLEPLARAFSNLEAELEVPIHVQGALSREKIYLEGELTRLASEMKDVNTQLKILRGNKRKLGYDAFSVGKFVGEVEKALSLMGESESESELSKEYKRLKKELSVLRLKIDPREFERKTKLQLAKVNKLASDWLPHLDTENPNAPISLHEKELTITVNSSGREDYLWEIGSGANWLSYHVAITLALHQHFSSLEASPVPNYIIYDQPSQVYFPSKLRHQATPEEDELALLEQDEDIVQVKKIFEAFNGAIEKTKDNLQIIVLDHAPSTLVKSIPKGHLVEEWRNGIKLIPLDWL

Source Source

Source organism organism	Vibrio cholerae
NCBI taxonomy ID ncbi_taxonomy_id	666
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	DNA
Molecular weight formula_weight	6221.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	E

GTGATAGTTAGAAACGTAAT

Source Source

Source organism organism	Vibrio cholerae
NCBI taxonomy ID ncbi_taxonomy_id	666
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	DNA
Molecular weight formula_weight	5121.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	F

ACGTTTCTAACTATCAC

Source Source

Source organism organism	Vibrio cholerae
NCBI taxonomy ID ncbi_taxonomy_id	666
Host organism host_organism	Escherichia coli

▶

Resolution resolution	2.930 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	2.93 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	190887

LmuABC-DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

LmuC

State in the Current Structure

Other States of the Same Protein in the Database

ABC-three component systems C-terminal domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

DUF3732 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9nyg__assembly_1__model_1

9nyg__assembly_1__model_1 | I(q)

9nyg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

7. Citations (1)

LmuABC-DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

LmuC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ABC-three component systems C-terminal domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DUF3732 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9nyg__assembly_1__model_1

9nyg__assembly_1__model_1 | I(q)

9nyg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

7. Citations (1)