9o17

Cryo-EM structure of Methanosarcina acetivorans 70S ribosome

Method: ELECTRON MICROSCOPY D_max: 293.1 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Small ribosomal subunit protein uS2

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AB； UniProt 1–247	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A832VZ76_9EURY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AB； PDBConstruct 1–247； UniProt 1–247

Small ribosomal subunit protein uS3

OrganismNot specified

UniProt Q8TRU1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AC； UniProt 1–318	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BC 1–318（318 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BC 1–318（318 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BC 1–318（318 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS3_METAC
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AC； PDBConstruct 1–318； UniProt 1–318

Small ribosomal subunit protein eS1

OrganismNot specified

UniProt Q8TKI9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AD； UniProt 1–203	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BA 1–203（203 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BA 1–203（203 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BA 1–203（203 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS3A_METAC
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AD； PDBConstruct 1–203； UniProt 1–203

Small ribosomal subunit protein uS4

OrganismNot specified

UniProt Q8TRR1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AE； UniProt 1–218	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BD 1–218（218 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BD 1–218（218 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BD 1–218（218 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS4_METAC
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AE； PDBConstruct 1–218； UniProt 1–218

Small ribosomal subunit protein eS4

OrganismNot specified

UniProt Q8TRT5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AF； UniProt 1–235	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BE 1–235（235 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BE 1–235（235 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BE 1–235（235 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS4E_METAC
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AF； PDBConstruct 1–235； UniProt 1–235

Small ribosomal subunit protein uS5

OrganismNot specified

UniProt Q8TRS7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AG； UniProt 1–209	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BF 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BF 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BF 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS5_METAC
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AG； PDBConstruct 1–209； UniProt 1–209

Small ribosomal subunit protein uS7

OrganismNot specified

UniProt Q8TRC2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AI； UniProt 1–189	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BH 1–189（189 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BH 1–189（189 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BH 1–189（189 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS7_METAC
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AI； PDBConstruct 1–189； UniProt 1–189

Small ribosomal subunit protein uS8

OrganismNot specified

UniProt Q8TRT2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AJ； UniProt 1–130	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BI 1–130（130 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BI 1–130（130 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BI 1–130（130 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS8_METAC
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain AJ； PDBConstruct 1–130； UniProt 1–130

Small ribosomal subunit protein eS8

OrganismNot specified

UniProt Q8TS82

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AK； UniProt 1–125	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BK 1–125（125 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BK 1–125（125 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BK 1–125（125 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS8E_METAC
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain AK； PDBConstruct 1–125； UniProt 1–125

Small ribosomal subunit protein uS9

OrganismNot specified

UniProt Q8TT42

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AL； UniProt 1–134	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BJ 1–134（134 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BJ 1–134（134 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BJ 1–134（134 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS9_METAC
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain AL； PDBConstruct 1–134； UniProt 1–134

Small ribosomal subunit protein uS11

OrganismNot specified

UniProt Q8TRR0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AN； UniProt 1–126	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BM 1–126（126 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BM 1–126（126 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BM 1–126（126 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS11_METAC
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain AN； PDBConstruct 1–126； UniProt 1–126

Small ribosomal subunit protein uS12

OrganismNot specified

UniProt Q8TRC1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AO； UniProt 1–142	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BN 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BN 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BN 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS12_METAC
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain AO； PDBConstruct 1–142； UniProt 1–142

Small ribosomal subunit protein uS13

OrganismNot specified

UniProt Q8TRR2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AP； UniProt 1–162	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BO 1–162（162 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BO 1–162（162 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BO 1–162（162 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS13_METAC
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain AP； PDBConstruct 21–182； UniProt 1–162

Small ribosomal subunit protein uS14

OrganismNot specified

UniProt Q8TRT3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AR； UniProt 1–50	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BP 1–50（50 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BP 1–50（50 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BP 1–50（50 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS14Z_METAC
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain AR； PDBConstruct 1–50； UniProt 1–50

Small ribosomal subunit protein uS15

OrganismNot specified

UniProt Q8TS56

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AQ； UniProt 1–152	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BQ 1–152（152 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BQ 1–152（152 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BQ 1–152（152 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS15_METAC
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain AQ； PDBConstruct 1–152； UniProt 1–152

Small ribosomal subunit protein uS17A

OrganismNot specified

UniProt Q8TRT8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AS； UniProt 1–109	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BR 1–109（109 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BR 1–109（109 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BR 1–109（109 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS17_METAC
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain AS； PDBConstruct 1–109； UniProt 1–109

Small ribosomal subunit protein uS19

OrganismNot specified

UniProt Q8TRU3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AU； UniProt 1–136	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BT 1–136（136 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BT 1–136（136 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BT 1–136（136 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS19_METAC
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain AU； PDBConstruct 1–136； UniProt 1–136

Small ribosomal subunit protein eS19

OrganismNot specified

UniProt A0A832W9Q0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AV； UniProt 1–149	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A832W9Q0_9EURY
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain AV； PDBConstruct 1–149； UniProt 1–149

Small ribosomal subunit protein eS24

OrganismNot specified

UniProt Q8TJT2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AW； UniProt 1–101	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BW 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BW 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BW 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS24_METAC
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain AW； PDBConstruct 1–101； UniProt 1–101

Small ribosomal subunit protein eS27

OrganismNot specified

UniProt P61931

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AX； UniProt 1–62	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BX 1–62（62 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BX 1–62（62 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BX 1–62（62 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS27_METAC
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain AX； PDBConstruct 1–62； UniProt 1–62

Small ribosomal subunit protein eS28

OrganismNot specified

UniProt Q8TQL8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AY； UniProt 1–76	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BY 1–76（76 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BY 1–76（76 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BY 1–76（76 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS28_METAC
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain AY； PDBConstruct 1–76； UniProt 1–76

Small ribosomal subunit protein eS6

OrganismNot specified

UniProt Q8TQL4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AH； UniProt 1–136	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BG 1–136（136 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BG 1–136（136 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BG 1–136（136 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS6E_METAC
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain AH； PDBConstruct 1–136； UniProt 1–136

Small ribosomal subunit protein uS10

OrganismNot specified

UniProt P61929

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AM； UniProt 1–102	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BL 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BL 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BL 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS10_METAC
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain AM； PDBConstruct 1–102； UniProt 1–102

Small ribosomal subunit protein eS17

OrganismNot specified

UniProt Q8THP2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AT； UniProt 1–64	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BS 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BS 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BS 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS17E_METAC
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain AT； PDBConstruct 1–64； UniProt 1–64

Large ribosomal subunit protein uL2

OrganismNot specified

UniProt Q8TRU4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BC； UniProt 1–238	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BC 1–238（238 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BC 1–238（238 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BC 1–238（238 aa） Chain CC 1–238（238 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AA 1–238（238 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AA 1–238（238 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AA 1–238（238 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL2_METAC
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain BC； PDBConstruct 1–238； UniProt 1–238

Large ribosomal subunit protein uL3

OrganismNot specified

UniProt Q8TRU7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BD； UniProt 1–337	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BD 1–337（337 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BD 1–337（337 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BD 1–337（337 aa） Chain CD 1–337（337 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AB 1–337（337 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AB 1–337（337 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AB 1–337（337 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL3_METAC
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain BD； PDBConstruct 1–337； UniProt 1–337

Large ribosomal subunit protein uL4

OrganismNot specified

UniProt Q8TRU6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BE； UniProt 1–253	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BE 1–253（253 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BE 1–253（253 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BE 1–253（253 aa） Chain CE 1–253（253 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AC 1–253（253 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AC 1–253（253 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AC 1–253（253 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL4_METAC
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain BE； PDBConstruct 1–253； UniProt 1–253

Large ribosomal subunit protein uL5

OrganismNot specified

UniProt Q8TRT4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BF； UniProt 1–165	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BF 1–165（165 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BF 1–165（165 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BF 1–165（165 aa） Chain CF 1–165（165 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AD 1–165（165 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AD 1–165（165 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AD 1–165（165 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL5_METAC
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain BF； PDBConstruct 1–165； UniProt 1–165

Large ribosomal subunit protein uL6

OrganismNot specified

UniProt Q8TRT1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BG； UniProt 1–176	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BG 1–176（176 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BG 1–176（176 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BG 1–176（176 aa） Chain CG 1–176（176 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AE 1–176（176 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AE 1–176（176 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AE 1–176（176 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL6_METAC
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain BG； PDBConstruct 1–176； UniProt 1–176

Large ribosomal subunit protein eL8

OrganismNot specified

UniProt Q8TQL9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BH； UniProt 1–120	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BH 1–120（120 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BH 1–120（120 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BH 1–120（120 aa） Chain CH 1–120（120 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AF 1–120（120 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AF 1–120（120 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AF 1–120（120 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL7A_METAC
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain BH； PDBConstruct 1–120； UniProt 1–120

Large ribosomal subunit protein uL16

OrganismNot specified

UniProt Q8TU90

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BI； UniProt 1–173	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BI 1–173（173 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BI 1–173（173 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BI 1–173（173 aa） Chain CI 1–173（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AK 1–173（173 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AK 1–173（173 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AK 1–173（173 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL10E_METAC
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain BI； PDBConstruct 1–173； UniProt 1–173

Large ribosomal subunit protein uL13

OrganismNot specified

UniProt Q8TT43

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BJ； UniProt 1–143	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BJ 1–143（143 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BJ 1–143（143 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BJ 1–143（143 aa） Chain CJ 1–143（143 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AG 1–143（143 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AG 1–143（143 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AG 1–143（143 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL13_METAC
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain BJ； PDBConstruct 1–143； UniProt 1–143

Large ribosomal subunit protein uL14

OrganismNot specified

UniProt Q8TRT7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BK； UniProt 1–132	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BK 1–132（132 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BK 1–132（132 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BK 1–132（132 aa） Chain CK 1–132（132 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AH 1–132（132 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AH 1–132（132 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AH 1–132（132 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL14_METAC
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain BK； PDBConstruct 1–132； UniProt 1–132

Large ribosomal subunit protein uL15

OrganismNot specified

UniProt Q8TRS5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BL； UniProt 1–140	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BL 1–140（140 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BL 1–140（140 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BL 1–140（140 aa） Chain CL 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AI 1–140（140 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AI 1–140（140 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AI 1–140（140 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL15_METAC
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain BL； PDBConstruct 1–140； UniProt 1–140

Large ribosomal subunit protein eL15

OrganismNot specified

UniProt Q8TPX0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BM； UniProt 1–196	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BM 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BM 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BM 1–196（196 aa） Chain CM 1–196（196 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AJ 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AJ 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AJ 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL15E_METAC
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain BM； PDBConstruct 1–196； UniProt 1–196

Large ribosomal subunit protein uL18

OrganismNot specified

UniProt Q8TRS8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BN； UniProt 1–174	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BN 1–174（174 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BN 1–174（174 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BN 1–174（174 aa） Chain CN 1–174（174 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AL 1–174（174 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AL 1–174（174 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AL 1–174（174 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL18_METAC
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain BN； PDBConstruct 1–174； UniProt 1–174

Large ribosomal subunit protein eL18

OrganismNot specified

UniProt Q8TT44

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BO； UniProt 1–126	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BO 1–126（126 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BO 1–126（126 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BO 1–126（126 aa） Chain CO 1–126（126 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AM 1–126（126 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AM 1–126（126 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AM 1–126（126 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL18E_METAC
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain BO； PDBConstruct 1–126； UniProt 1–126

Large ribosomal subunit protein eL19

OrganismNot specified

UniProt A0A832W9G6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BP； UniProt 1–151	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BP 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BP 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BP 1–151（151 aa） Chain CP 1–151（151 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AN 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AN 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AN 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A832W9G6_9EURY
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain BP； PDBConstruct 1–151； UniProt 1–151

Large ribosomal subunit protein eL20

OrganismNot specified

UniProt Q8TIN5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BQ； UniProt 1–61	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BQ 1–61（61 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BQ 1–61（61 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BQ 1–61（61 aa） Chain CQ 1–61（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AO 1–61（61 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AO 1–61（61 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AO 1–61（61 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL18A_METAC
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain BQ； PDBConstruct 1–61； UniProt 1–61

Large ribosomal subunit protein eL21

OrganismNot specified

UniProt Q8TQU3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BR； UniProt 1–97	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BR 1–97（97 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BR 1–97（97 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BR 1–97（97 aa） Chain CR 1–97（97 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AP 1–97（97 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AP 1–97（97 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AP 1–97（97 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL21_METAC
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain BR； PDBConstruct 1–97； UniProt 1–97

Large ribosomal subunit protein uL22

OrganismNot specified

UniProt Q8TRU2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BS； UniProt 1–151	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BS 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BS 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BS 1–151（151 aa） Chain CS 1–151（151 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AQ 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AQ 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AQ 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL22_METAC
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain BS； PDBConstruct 1–151； UniProt 1–151

Large ribosomal subunit protein uL23

OrganismNot specified

UniProt Q8TRU5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BT； UniProt 1–82	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BT 1–82（82 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BT 1–82（82 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BT 1–82（82 aa） Chain CT 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AR 1–82（82 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AR 1–82（82 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AR 1–82（82 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL23_METAC
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain BT； PDBConstruct 1–82； UniProt 1–82

Large ribosomal subunit protein uL24

OrganismNot specified

UniProt Q8TRT6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BU； UniProt 1–119	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BU 1–119（119 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BU 1–119（119 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BU 1–119（119 aa） Chain CU 1–119（119 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AS 1–119（119 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AS 1–119（119 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AS 1–119（119 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL24_METAC
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain BU； PDBConstruct 1–119； UniProt 1–119

Large ribosomal subunit protein eL24

OrganismNot specified

UniProt Q8TQL7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BV； UniProt 1–62	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BV 1–62（62 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BV 1–62（62 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BV 1–62（62 aa） Chain CV 1–62（62 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AT 1–62（62 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AT 1–62（62 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AT 1–62（62 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL24E_METAC
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain BV； PDBConstruct 1–62； UniProt 1–62

Large ribosomal subunit protein uL29

OrganismNot specified

UniProt Q8TRU0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BW； UniProt 1–67	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BW 1–67（67 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BW 1–67（67 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BW 1–67（67 aa） Chain CW 1–67（67 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AU 1–67（67 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AU 1–67（67 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AU 1–67（67 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL29_METAC
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain BW； PDBConstruct 1–67； UniProt 1–67

Large ribosomal subunit protein uL30

OrganismNot specified

UniProt Q8TRS6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BX； UniProt 1–153	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BX 1–153（153 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BX 1–153（153 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BX 1–153（153 aa） Chain CX 1–153（153 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AV 1–153（153 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AV 1–153（153 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AV 1–153（153 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL30_METAC
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain BX； PDBConstruct 1–153； UniProt 1–153

Large ribosomal subunit protein eL30

OrganismNot specified

UniProt Q8TRB9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BY； UniProt 1–99	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BY 1–99（99 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BY 1–99（99 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BY 1–99（99 aa） Chain CY 1–99（99 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AW 1–99（99 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AW 1–99（99 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AW 1–99（99 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL30E_METAC
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain BY； PDBConstruct 1–99； UniProt 1–99

Large ribosomal subunit protein eL31

OrganismNot specified

UniProt Q8TIN3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain BZ； UniProt 1–89	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BZ 1–89（89 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain BZ 1–89（89 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain BZ 1–89（89 aa） Chain CZ 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AX 1–89（89 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AX 1–89（89 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AX 1–89（89 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL31_METAC
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain BZ； PDBConstruct 1–89； UniProt 1–89

Large ribosomal subunit protein eL32

OrganismNot specified

UniProt A0A832W8Z7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain Ba； UniProt 1–158	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain Ba 1–158（158 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain Ba 1–158（158 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain Ba 1–158（158 aa） Chain Ca 1–158（158 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A832W8Z7_9EURY
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain Ba； PDBConstruct 4–161； UniProt 1–158

Large ribosomal subunit protein eL43

OrganismNot specified

UniProt A0A832SMV9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain Bb； UniProt 1–94	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain Bb 1–94（94 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain Bb 1–94（94 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain Bb 1–94（94 aa） Chain Cb 1–94（94 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Ad 1–94（94 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain Ad 1–94（94 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain Ad 1–94（94 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A832SMV9_9EURY
Isoform	—
PDB entities	53
Chains and sequence ranges	Author chain Bb； PDBConstruct 1–94； UniProt 1–94

Large ribosomal subunit protein eL37

OrganismNot specified

UniProt Q8TL48

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain Bc； UniProt 1–56	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain Bc 1–56（56 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain Bc 1–56（56 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain Bc 1–56（56 aa） Chain Cc 1–56（56 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain AZ 1–56（56 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain AZ 1–56（56 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain AZ 1–56（56 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL37_METAC
Isoform	—
PDB entities	54
Chains and sequence ranges	Author chain Bc； PDBConstruct 1–56； UniProt 1–56

Large ribosomal subunit protein eL39

OrganismNot specified

UniProt Q8TIN2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain Bd； UniProt 1–51	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain Bd 1–51（51 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain Bd 1–51（51 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain Bd 1–51（51 aa） Chain Cd 1–51（51 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Aa 1–51（51 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain Aa 1–51（51 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain Aa 1–51（51 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL39_METAC
Isoform	—
PDB entities	55
Chains and sequence ranges	Author chain Bd； PDBConstruct 1–51； UniProt 1–51

Large ribosomal subunit protein eL40

OrganismNot specified

UniProt Q8TJ19

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain Be； UniProt 1–49	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain Be 1–49（49 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain Be 1–49（49 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain Be 1–49（49 aa） Chain Ce 1–49（49 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Ab 1–49（49 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain Ab 1–49（49 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain Ab 1–49（49 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL40_METAC
Isoform	—
PDB entities	56
Chains and sequence ranges	Author chain Be； PDBConstruct 4–52； UniProt 1–49

Large ribosomal subunit protein eL42

OrganismNot specified

UniProt A0A832W9V9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain Bf； UniProt 1–92	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Putative zinc finger domain-containing protein × 1 （A0A832S8D7） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9NRI Methanosarcina acetivorans 50S subunit obtained from acetate-grown cells Deposited 2025-03-14	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain Bf 1–92（92 aa）	Not recorded	MG MAGNESIUM ION × 43 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NTA Methanosarcina acetivorans 50S subunit obtained from methanol-grown cells Deposited 2025-03-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 32-meric	Chain Bf 1–92（92 aa）	Not recorded	MG MAGNESIUM ION × 43 K POTASSIUM ION × 11 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9OU7 Methanosarcina acetivorans large (50S) subunit dimer Deposited 2025-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 68-meric	Chain Bf 1–92（92 aa） Chain Cf 1–92（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Ac 1–92（92 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain Ac 1–92（92 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain Ac 1–92（92 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A832W9V9_9EURY
Isoform	—
PDB entities	57
Chains and sequence ranges	Author chain Bf； PDBConstruct 1–92； UniProt 1–92

Putative zinc finger domain-containing protein

OrganismNot specified

UniProt A0A832S8D7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 55 RNA 3 PDB declaration: 58-meric（58） Consistent with all polymer counts	Chain AZ； UniProt 1–56	Not recorded	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （A0A832VZ76） Small ribosomal subunit protein uS3 × 1 （Q8TRU1） Small ribosomal subunit protein eS1 × 1 （Q8TKI9） Small ribosomal subunit protein uS4 × 1 （Q8TRR1） Small ribosomal subunit protein eS4 × 1 （Q8TRT5） Small ribosomal subunit protein uS5 × 1 （Q8TRS7） Small ribosomal subunit protein uS7 × 1 （Q8TRC2） Small ribosomal subunit protein uS8 × 1 （Q8TRT2） Small ribosomal subunit protein eS8 × 1 （Q8TS82） Small ribosomal subunit protein uS9 × 1 （Q8TT42） Small ribosomal subunit protein uS11 × 1 （Q8TRR0） Small ribosomal subunit protein uS12 × 1 （Q8TRC1） Small ribosomal subunit protein uS13 × 1 （Q8TRR2） Small ribosomal subunit protein uS14 × 1 （Q8TRT3） Small ribosomal subunit protein uS15 × 1 （Q8TS56） Small ribosomal subunit protein uS17A × 1 （Q8TRT8） Small ribosomal subunit protein uS19 × 1 （Q8TRU3） Small ribosomal subunit protein eS19 × 1 （A0A832W9Q0） Small ribosomal subunit protein eS24 × 1 （Q8TJT2） Small ribosomal subunit protein eS27 × 1 （P61931） Small ribosomal subunit protein eS28 × 1 （Q8TQL8） Small ribosomal subunit protein eS6 × 1 （Q8TQL4） Small ribosomal subunit protein uS10 × 1 （P61929） Small ribosomal subunit protein eS17 × 1 （Q8THP2） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8TRU4） Large ribosomal subunit protein uL3 × 1 （Q8TRU7） Large ribosomal subunit protein uL4 × 1 （Q8TRU6） Large ribosomal subunit protein uL5 × 1 （Q8TRT4） Large ribosomal subunit protein uL6 × 1 （Q8TRT1） Large ribosomal subunit protein eL8 × 1 （Q8TQL9） Large ribosomal subunit protein uL16 × 1 （Q8TU90） Large ribosomal subunit protein uL13 × 1 （Q8TT43） Large ribosomal subunit protein uL14 × 1 （Q8TRT7） Large ribosomal subunit protein uL15 × 1 （Q8TRS5） Large ribosomal subunit protein eL15 × 1 （Q8TPX0） Large ribosomal subunit protein uL18 × 1 （Q8TRS8） Large ribosomal subunit protein eL18 × 1 （Q8TT44） Large ribosomal subunit protein eL19 × 1 （A0A832W9G6） Large ribosomal subunit protein eL20 × 1 （Q8TIN5） Large ribosomal subunit protein eL21 × 1 （Q8TQU3） Large ribosomal subunit protein uL22 × 1 （Q8TRU2） Large ribosomal subunit protein uL23 × 1 （Q8TRU5） Large ribosomal subunit protein uL24 × 1 （Q8TRT6） Large ribosomal subunit protein eL24 × 1 （Q8TQL7） Large ribosomal subunit protein uL29 × 1 （Q8TRU0） Large ribosomal subunit protein uL30 × 1 （Q8TRS6） Large ribosomal subunit protein eL30 × 1 （Q8TRB9） Large ribosomal subunit protein eL31 × 1 （Q8TIN3） Large ribosomal subunit protein eL32 × 1 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 1 （A0A832SMV9） Large ribosomal subunit protein eL37 × 1 （Q8TL48） Large ribosomal subunit protein eL39 × 1 （Q8TIN2） Large ribosomal subunit protein eL40 × 1 （Q8TJ19） Large ribosomal subunit protein eL42 × 1 （A0A832W9V9） MG MAGNESIUM ION × 51 ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.92 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9O17	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9ZNF Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriA and SriB Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BV 1–56（56 aa）	Not recorded	MG MAGNESIUM ION × 305 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.03 Å
9ZNG Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain BV 1–56（56 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
9ZNI Cryo-EM structure of the Methanosarcina acetivorans 70S ribosome in complex with SriC and SriD Deposited 2025-12-12	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 61-meric	Chain BV 1–56（56 aa）	Not recorded	MG MAGNESIUM ION × 314 ZN ZINC ION × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A832S8D7_9EURY
Isoform	—
PDB entities	58
Chains and sequence ranges	Author chain AZ； PDBConstruct 1–56； UniProt 1–56

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9o17
Deposition date deposition_date	2025-04-03
Structure title title	Cryo-EM structure of Methanosarcina acetivorans 70S ribosome
Keywords keywords	Archaea, Methanosarcina acetivorans, 70S ribosome, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	84.11 Å
Radius of gyration Rg (electron density) rg_electron	85.48 Å
Forward intensity I(0) i0	150186000000.00
Molecular weight molecular_weight	2215300.0 kDa
Excluded volume excluded_volume	2320700 Å³
Envelope volume envelope_volume	3894000 Å³
Hydration-shell volume shell_volume	348950 Å³
Envelope diameter envelope_diameter	271.6 Å
Shell Rg shell_rg	99.37 Å
Envelope Rg envelope_rg	83.65 Å
Shape Rg shape_rg	85.56 Å
Total Rg total_rg	85.37 Å
Total atoms total_atoms	179267
Residues n_residues	11529
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	293.1 Å
Rg (real space) rg_real	86.03 Å
Rg uncertainty (real space) rg_real_error	1.59 Å
I(0) (real space) i0_real	1.4940e+11
I(0) uncertainty (real space) i0_real_error	3.1470e+09
Rg (reciprocal space) rg_reciprocal	85.41 Å
I(0) (reciprocal space) i0_reciprocal	150800000000.0000
Solution quality estimate total_estimate	0.9019
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	108.0 Å
Skewness Skewness skewness	0.332
Kurtosis Kurtosis kurtosis	-0.070
Angular range angular_range	— – 0.0950 Å⁻¹
Current regularization parameter α current_alpha	0.9778
Highest regularization parameter α highest_alpha	8743000000.0000
Real-space data points n_real_points	20
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.803; Stabil: 0.932; Sysdev: 1.000; Positv: 1.000; Valcen: 0.964; Smooth: 0.769

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (60)

Entity 1 Entity 1 polymer

Description description	16S rRNA
Molecular weight formula_weight	478373.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AA
Atom count atom_count	179267

AUUCUGGUUGAUCCUGCCAGAGGUUACUGCUAUCGGUGUUCGCCUAAGCCAUGCGAGUCAUAUGUUCUUUGUGAACAUGGCGUACUGCUCAGUAACACGUGGAUAACCUGCCCUUGGGUCCGGCAUAACCCCGGGAAACUGGGGAUAAUACCGGAUAACGCACAUAUGCUGGAAUGCUUUCUGCGUAAAACGGAUUCGUCUGCCCAAGGAUGGGUCUGCGGCCUAUCAGGUAGUAGUGGGUGUAACGUACCUACUAGCCGACAACGGGUACGGGUUGUGAGAGCAAGAGCCCGGAGAUGGAUUCUGAGACAUGAAUCCAGGCCCUACGGGGCGCAGCAGGCGCGAAAACUUUACAAUGCGGGAAACCGUGAUAAGGGGACACCGAGUGCCAGCAUCAUAUGCUGGCUGUCCGGAUGUGUAAAAUACAUCUGUUAGCAAGGGCCGGGCAAGACCGGUGCCAGCCGCCGCGGUAACACCGGCGGCCCGAGUGGUGAUCGUGAUUAUUGGGUCUAAAGGGUCCGUAGCCGGUUUGGUCAGUCCUCCGGGAAAUCUGACAGCUCAACUGUUAGGCUUUCGGGGGAUACUGCCAGACUUGGAACCGGGAGAGGUAAGAGGUACUACAGGGGUAGGAGUGAAAUCUUGUAAUCCCUGUGGGACCACCUGUGGCGAAGGCGUCUUACCAGAACGGGUUCGACGGUGAGGGACGAAAGCUGGGGGCACGAACCGGAUUAGAUACCCGGGUAGUCCCAGCCGUAAACGAUGCUCGCUAGGUGUCAGGCAUGGCGCGACCGUGUCUGGUGCCGCAGGGAAGCCGUGAAGCGAGCCACCUGGGAAGUACGGCCGCAAGGCUGAAACUUAAAGGAAUUGGCGGGGGAGCACAACAACGGGUGGAGCCUGCGGUUUAAUUGGACUCAACGCCGGACAACUCACCGGGGACGACAGCAAUAUGUAGGCCAGGCCGAAGACCUUGCCUGAAUCGCUGAGAGGAGGUGCAUGGCCGUCGCCAGUUCGUACUGUGAAGCAUCCUGUUAAGUCAGGCAACGAGCGAGACCCGUGCCCACUGUUACCAGCAUGUCCUCCGGGACGAUGGGUACUCUGUGGGGACCGCCGGUGUUAAAUCGGAGGAAGGUGCGGGCCACGGUAGGUCAGUAUGCCCCGAAUUUCCCGGGCUACACGCGGGCUACAAUGAAUGGGACAAUGGGUCCCUCCCCUGAAAAGGGCUGGUAAUCUCACAAACCCAUCCGUAGUUCGGAUCGAGGGCUGUAACUCGCCCUCGUGAAGCUGGAAUCCGUAGUAAUCGCGUUUCAAUAUAGCGCGGUGAAUACGUCCCUGCUCCUUGCACACACCGCCCGUCAAACCACCCGAGUGAGGUAUGGGUGAGGGCACGGACUUCGUGCCGUGUUCGAACCUGAAUUUUGCAAGGGGGGUUAAGUCGUAACAAGGUAGCCGUAGGGGAAUCUGCGGCUGGAUCACCUCCU

Entity 2 Entity 2 polymer

Description description	Small ribosomal subunit protein uS2
Molecular weight formula_weight	27234.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB

MEEIEQTGQEETGAQPMPEEDVVAEAKPALEKEAAVKTGSIPSESEDETASHKEGSTSLVSIDEYLAAGVHIGTQQKTQDMMRFVYRVRTDGLYVLDIQSTDERIRVASKLLSHYDPARILVVSSRQYGQHPARMFSRALGTRAMLGRFIPGSLTNPQIHGFFEPDVIIVTDPAGDAQVLKEASSIGVPVVALCDTNNLTSNVDLVIPTNNKGRKALSLVYWLLAREVSRLNDTPFNYELTDFETPL

Entity 3 Entity 3 polymer

Description description	Small ribosomal subunit protein uS3
Molecular weight formula_weight	34780.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC

MAIEKKFVNDGYVKASMDEYFAEQLSRAGYGGMELNRTPMGTQIVIYSEKPGMVIGKAGKVIRKLTRDVANKYSLENPQIDAQEVKRPELNAQMMASRLAASIERGWYFRKAGHNTLRAVMNAGALGCEVVISGKLTGARSRVEKFVDGYIKHSGNPVEEVVDEGFAVAVKKLGTLGCKVRIIQPGVVLPDSYKVRESVEVEEPAEKPAEKPAEKPAEKAAAPKKEAAKARAPAPAPEAPAPAPEAPAPAPVEEAEVAEPEEAEEVQAETSEEIEGAELVYVEGSDEVRRQVNGVWQHKHGSYDYWHPMARVHKEAKE

Entity 4 Entity 4 polymer

Description description	Small ribosomal subunit protein eS1
Molecular weight formula_weight	22938.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AD

MARKKVQRKLDGWKSKEWYNIEAPVYLNRAIVGNTMAGDPSLLVGRNVETTVGELTNDMTKNNTKVILRINNVVGDIATTDLMGHELTTDYIRSIVKRQTSRIDANVDVKTKDGYVIRVKPTCFTIKRARSSQMQAIREMMVEIVKKRAAESDFETFMQEAILGRLSAAIYRQAKFIYPLRRVEIRKTEVETIPAAAPAPAAA

Entity 5 Entity 5 polymer

Description description	Small ribosomal subunit protein uS4
Molecular weight formula_weight	24559.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AE

MAYPGKKSKSYETPKHPWQEARMATEVQLVKAYGLRNKKEVWKAASMLRMYRSEARKLLAHVASGQEGGLEGHYRTQSEEILSKLIRYGIIKSDANIDDILSLKTENILERRLQTQVLRLGLARTVIQARQFITHGHIAINGRKATIPGMLVSKEDEMHIGYYGNSPLKNESHPERPVQVASFLADSGTTLKAAAEAKQAREKPPERGGGRRKRGGRR

Entity 6 Entity 6 polymer

Description description	Small ribosomal subunit protein eS4
Molecular weight formula_weight	26301.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AF

MTHQKRLSVPKSWKVGKKGNKWISTTRPGPHSQARSLPLGIIIRDILKLVDNSREGKRILSEGKVLVDGIPRKDLRFPVGLFDVITLPLVNEAYRMLQDEKGRLTLHKLNETNVNKLCRINNKTTVKGGKFQLNLNDGTNIIGSNEYGTKDSLILSIPDKQVVKHLKFEVGNLAMVVGGQHSGETGKIMEIREVKSSRHNTVMISGETDFETIEDYVIVIGEDKPEIRLGGEISE

Entity 7 Entity 7 polymer

Description description	Small ribosomal subunit protein uS5
Molecular weight formula_weight	22732.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AG

MAFDQDWVPKTRLGKLVVEGQVASMDEAIKSGLPIREPQIIDMLLPDLEDEVLDINMVQRMTDSGRRVKFRATVIVGNRNGYVGLGQAKDVQVGPAIRKAIDAAKLNITYIRRGCGSWECACGLPHTVPYEVTGKAGSVSVTLIPAPRGLGIAAGNTATKVLEKAGIKDVWTKTFGTTRSTLNFAKATYDALNQVNVVRLPVYYGKEEV

Entity 8 Entity 8 polymer

Description description	Small ribosomal subunit protein uS7
Molecular weight formula_weight	21062.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AI

MIFLYKIFGKWDPTEVEVKDLGIKRYVSLTPVIVPHSSGKHARQQFNKSEISIVERLANNLMRTETNTGKKQVTLRAVEEAFDIVNKKTKQNPIQVLVDAIANAGPREEVVRLKYGGISVPKAVDTAPQRRVDTALRYISMGTNAAAFKSKRSVAECLATELIGAANRDTKSFSINRKDAKERVAKAAR

Entity 9 Entity 9 polymer

Description description	Small ribosomal subunit protein uS8
Molecular weight formula_weight	14085.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ

MVLLDPLANALSTIKNAEAIGKSSCVVRPASKNIGNVLKVMQDLGYIGDFEFIDDGKAGIYSVTLVGRINKCGAIKPRYSVGTASFERWEKQFLPAKNFGALIVTTSSGVMSQYEARDKKIGGQLLAYVY

Entity 10 Entity 10 polymer

Description description	Small ribosomal subunit protein eS8
Molecular weight formula_weight	13802.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK

MRWQGSSRRKATGGKVITARGKRKFEMGRESAETRISEIKRKKVPTMGGNRKVRLLQSNVANVTNPKDGKTVTAPIETVIDNTANKHYVRRNILTKGSVIRTSMGTARVTSRPGQDGVVNAVLIE

Entity 11 Entity 11 polymer

Description description	Small ribosomal subunit protein uS9
Molecular weight formula_weight	14512.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL

MVKVVNSSGKHKTATARATVMKGTGKVRINKIPLELYTPELAMMKISEPLLIAGNDVVSGLDINVDVRGGGIIGQANAVRTAVARGIVEWTNDTAIRDNFAAYDRNLLVSDSRQKESKNFGGPGARAKYQKSYR

Entity 12 Entity 12 polymer

Description description	Small ribosomal subunit protein uS11
Molecular weight formula_weight	13324.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AN

MADMKWAVAHIKSSFNNTIITVTDITGAETIAKSSGGMVVKAARDESSPYTAMQMAGQLADQLKDKGINGIHIRVRAPGGNKQRSPGPGAQAAIRAFARAGIRIGRIEDVTPVPHDGTRPKGGRRV

Entity 13 Entity 13 polymer

Description description	Small ribosomal subunit protein uS12
Molecular weight formula_weight	15540.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AO

MAKGKYAANILKQTRKDARWKDTYYGRRVLGLNVKADPLGGAPQGRGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGRQVTAFCPGDGAVNFIDEHDEVTVEKIGGRMGGAMGDIPGVRFKVIAVNNVSLNQLVIGRMEKPRR

Entity 14 Entity 14 polymer

Description description	Small ribosomal subunit protein uS13
Molecular weight formula_weight	20693.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AP

MRAAPEFSAYSLRVFDRGYRMLYALQWRKYMVEENNNEELRHLVRIMNTDLQGAKPVQYALTGLPGVGRRTAKLIAKGAGVDPSAILGYLPEEEVAKLDTAIGKFEDIVPSWMLNRQKDLATGQDKHLLGTDILLTFREDINNLKKVRAYRGLRHERGLKVRGQRTKSTGRRGSTVGVSRKK

Entity 15 Entity 15 polymer

Description description	Small ribosomal subunit protein uS14
Molecular weight formula_weight	5971.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AR

MTETIKKSGRGVNECKRCGRKQGLVRKYDIYLCRHCFREIAHEMGFEKYS

Entity 16 Entity 16 polymer

Description description	Small ribosomal subunit protein uS15
Molecular weight formula_weight	17503.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AQ

MAKMHTKRKGKSSSTRPIRTDPPEWCKIGADEVTTIVLDLWKQGVSTAEIGMVLRDRYGVPDAKLITGKKVTTILKENNVAPNIPEDLTNLIVKALGLRKHLSVNKKDVHNKRSLNLTESKIRRLVKYYKQEKVLPRDWFYKPETAEMMITR

Entity 17 Entity 17 polymer

Description description	Small ribosomal subunit protein uS17A
Molecular weight formula_weight	12184.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS

MARDIGLNIPAPSEECDDAYCPFHGTLPVRGQILVGTVVSSKMDNTVVIERQYMKMVSKYQRYEKRRSKIHAHNPACISAKVGDIVTIAECRPISKTKSYVVVKAEVPK

Entity 18 Entity 18 polymer

Description description	Small ribosomal subunit protein uS19
Molecular weight formula_weight	15467.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AU

MAKKSSSRLPKRKGEYTYRGKTVSELQELSLEEFAELLPSRERRSLKRGFTDGQKKVLHEFKEGKKIRTHHRDMIILPEMIGKTIEIHNGKGFVSVDLQPEMVGHRFGEFAPTRSRVSHGSAGVGATRSSKFVPLK

Entity 19 Entity 19 polymer

Description description	Small ribosomal subunit protein eS19
Molecular weight formula_weight	16563.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AV

MTTVFDVPATEMIEKLAGILKEDDKIVPPEWAGNVKTGVHKELPPTNDDWWYIRCAAVLRKIYTDGPIGIERLRSVYGGKKDNGSKPFHKAKGSGSVARKTVQQLEAAGFLQKVKDGRTVSAKGRSMMDNAAHELKLELLEKIPELAKY

Entity 20 Entity 20 polymer

Description description	Small ribosomal subunit protein eS24
Molecular weight formula_weight	11620.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AW

MDIKILKDKNNSLLNRRELDFVVKYEGSTPSRSDVRNKLAAMLNAPLELLIIQRIKTEYGMQESKGYAKVYADEARMKQVEQEYILKRNPAPGAEAEEEEA

Entity 21 Entity 21 polymer

Description description	Small ribosomal subunit protein eS27
Molecular weight formula_weight	6955.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AX

MVDYTQRPKSRFLRVKCNDCENEQIIFGSASRKITCVVCGRTLAEPTGGKSTITTHILEVLE

Entity 22 Entity 22 polymer

Description description	Small ribosomal subunit protein eS28
Molecular weight formula_weight	8268.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AY

MLIMAEESTIGGFAAEVIDVIGNTGMHGEASQIQCRVLEGRDKGRVITRNCVGPVRIGDILMLLETSREAKKLTTR

Entity 23 Entity 23 polymer

Description description	Small ribosomal subunit protein eS6
Molecular weight formula_weight	14474.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AH

MANFKVVVSDPKEGRAYQIDIKDAEANALIGKAIGDVVDGAIFGLAGYKVQITGGCDGSGFVMKPDLPGPRRQRILTATGVGYVPKLPGQRRRKMMRGKEIAPDIIQVNAKIVEYGSKSIKALLGLETAEEAPAAE

Entity 24 Entity 24 polymer

Description description	Small ribosomal subunit protein uS10
Molecular weight formula_weight	11380.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AM

MQKARIRLSGISPKDLDGVCNQVKSIAERTGVNISGPVPLPTKKLVVPTRKSPSGDGTATWDHWEMRVHKRLIDIAADERALRQLMRIQVPKDINIEIVLEG

Entity 25 Entity 25 polymer

Description description	Small ribosomal subunit protein eS17
Molecular weight formula_weight	7477.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AT

MGNIRETNIKRTAFSLLENYGDVFTKDFETNKALVTKYTTIESKIIRNRVAGYVTRKVARMKVY

Entity 26 Entity 26 polymer

Description description	23S rRNA
Molecular weight formula_weight	937667.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	BA

AGGAAUUAUGCUAUCAGGUGGAUGGCUCGGCUCAAGAGCUUAUGAAGGACGUGCCAAGCUGCGAUAAGCCCGGGGUAGGUGCAUGGAGCCAAUGAACCCGGGAUUUCCGAAUGGGACCUCUCCGUAGUGAUCAUUCAUGAUCGGGAACGCUCCGAAUUGAAACAUCUCAGUAGGAGCGGGAAAAGAAAUCAAUUGAGAUGCCGUAAGUAACGGCGAGUGAAACCGGCACAGUUCAAACCGAAUCCCUUCGGGGACAUGUGGUGUUGUAGGGCUGUUCAAACGUCUGGCGGUAAAAUCGAACUUGCCUGGAACGGCAGACCAUAGAGUGUGACAGUCACUUAGAUGUACGCCAAAAGACCGGAACAUGUCCCUGAGUACCGUGCGUUGGAUAUCGUGCGUGAAUCUGGGGGGCACCAACCUCCAAAACUAAAUACUCCUUGAGACCGAUAGCGAAAUAGUAGGGUGACCGAACGCUGAAAAGUACCCCGAGAAGGGAGGUGCAAAGUGCCUGAAACCUGAUAGUGAUGGAACGAUACGGCAUGAAAGGAUCUCUGGCAUGAAGGAAUCAUUCGCGAGGAUGUAGUACGAAUGUCACUGCCAGUGUCGUAUCUUACGUUUUGAAGAACGGGCCAGGGAGUGUAUCUUGGUGGCAAUGGCUAACCUUUUAUCUGGGCAGCCGAAGCGAAAGCAACAUGUGCGCAGCCUUUUGGCGAGGCACGACGUAUACAAGUGCGUGGAGUCACCGGGGUACGACCCGAAGCCGGGUGAUCUAGGCGUGGGCAGGUUGAAGCGUGGCGAAAGCUACGUGGAGGACCGUAAACGGUAUUGAUCUGCAAAUCAUUCGUGUGACCUGCGUCUCGUAGUGAAAUGCUAAUCUAACCCGGCAUCCGCUGGUUCCUUCCGAAACAUGUCGCAGCAUGACCUGACUUGAGAUCGUCGGUGGAGUAGAGCACUGAUUGGCGAUUCCGGGGGAGAAAUCCCUCGCUCGCUUGUCAAACUCCAAACCCCCCGUCAUCCUAGAAAGUCGGAGUCCGGACUGCUGGGGUAAGCUUGUAGUCCGUAAGGGAGACAACCCAGCCCGUGGUUAAGGUCCCCAAGUGUCGACUAAGUGUUAAUACUAAAGGGCGUCCCAAGCCCCAGACAGCUGGAAGGUUAGCUUAGAAGCAGCUACCCUUCAAAGAGUGCGUAACAGCUCACCAGUCGAGGUUUGGGGCCCCGAAAAUUGACGGGGCUCAAGUCGACCACCGAUACCACGGAGUACCGCAAGGUAAUCUCGUAGGAAGGCGUUGUGUUCGGGUCGAAGCAGGGCUGUGAAGUCCUGUGGACCGUUCACAAACGAAAAUCCUGGUAAUAGUAGCAGCAAAGCAGGGUGAGACUCCCUGCCGCCGAAGGGGCCAGGUUUCCUCGGCAAUGUUCGUCAGCCGAGGGUUAGUCGGUCCUAAGACGUACCGUAAUUCGAGUACGCCGAAAGGGAAACAGGUUAAUAUUCCUGUACCAUUUAGCGUUUAGUCUGACGUCUCAGGGCAAGCCGAGCGGCGUCGUCGCGCCGUCUAAGCAGCGAACCCCGUGGAGAGCCGUAAUGGCGAGAAGCGGGCGAAUCUGUAAUGGCACAAGUCGGCUUCACCCCGGGACCCGUGAAAAGGACAGCUAAAUGUCCGUACCGAGAACUGACACAGGUGCCCCUAGCUGAAAAGGCUAAGGCGUGUCGGAGUAAUUCAGUUAAGGGAAUUCGGCAAAUUAGCUCCGUAACUUCGGGAUAAGGAGUGCCUGCUGUGUAGACAGCAGGUCGCAGUGACCAGGGGGCUCUAACUGUCUAAUACCAACAUAGGAGAUUGCAAACCCGUAAGGGCUAGUACAAUCUCUGAAUCCUGCUCAGUGCAGGUACCUGAAACCCCGGUUCAACGGGAAGAAGGGCCUGUAAACAGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGUCGCUUAAUUGGCGACUUGCAUGAAUGGAUCAAUGAGAGCCCUACUGUCCCUAACUGGAGUCCGGUGAAGCUUACAUUCUAGUGCACAGUCUAGAGACCUCUAGGGGGAAGUGAAGACCCCGUGGAGCUUUACUGCAGCCUGUCGUUGGGUUGUGGUUCUGGAUGUACAGUGUAGGUAGGAGGCAUCGAAGCGGGUGCGCCAGCAUUCGUGGAGCCGUCCUUGGGACACUACCCUUCCGGGACUACGACCCUAACUCUGAGAAGAGGACCCCGAUAGGUGGGCAGUUUGCCUGGGGCGGGACGCCCUUGAAAAGAUAUCAAGGGCGCGCAAUGGUUGACUCAAGCGGGUCGGAAACUCGCUGAAGAGUGCAAGAGCAUAAGUCAGCCUGACGUUAUUCAGCAUAGCAGUGGAUGACGAGACGAAAGUCGGCUCUAGCGAACUUUUGAGCCUCCUUGGUGGGGGCCAAAAAUGACAGAAAAGUUACCCCGGGGAUAAUUGAGUCGUUGCCGGCAAGAGUACAUAUCGACCCGGCAGCUUGCUACCUCGAUGUCGGUUCUUUCCAUCCUGGCCGUGCAGCAGCGGCCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGAUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUCGGUUACUAUCUACUAGAGGUGCCCGAGGUCUGCGGGUAAGCUGCUUUUAGUACGAGAGGAACCAAGCAGCGGCGCCACUGGUGUACCGGUUGUCUGACAAGGCAUCGCCGGGCAGCUACGCGCUCAGGAAUAAGAGCUGAAUGCAUCUAAGCUCGAACUCUGACCUAAAAAGAGACCUCUUUAAGGAUUCCGGUAAAAGACCGGUUUGAUAGAAACGGGAUGUAAGCACCAAGGCAACGAGGUGUUCAGUCCGCGUUUACUAACCAUUCGUUCCUUUCACUU

Entity 27 Entity 27 polymer

Description description	5S rRNA
Molecular weight formula_weight	41399.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	BB

GAGUUUGGCGGCCAUAGCGGUAGGGCAACUCCUGUACCCAUCCCGAACACAGCAGAUAAGCCUGCCCGCGUUCCUUACUGUACUGAAGUGUGCGAGCCUUCGGGAACUCUGGAUCGCUGCCAAGCUCAC

Entity 28 Entity 28 polymer

Description description	Large ribosomal subunit protein uL2
Molecular weight formula_weight	25738.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BC

MGKRLISQNRGRGTPTYRAPSHKYKADLRHPRVDENSSLRGEVVGIEHDPARSAPIAKVAFENGEELFLLASEGIAVGNIIECGDDAEVKPGNIVPIGNVPEGFFICNVESKPNDGGKFVRSSGVYATVVTHEATRTAVSMPSGNIKWLNPKCRAVVGIVAGSGRVDRPWLKAGKKYHKMKTRAAKYPRVSAVAMNPRDHPFGGGAWKHPGKPTTVSRNAPPGRKVGLIAARRTGMKR

Entity 29 Entity 29 polymer

Description description	Large ribosomal subunit protein uL3
Molecular weight formula_weight	36949.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BD

MASIHRPKRGSLAFSPRKRAKSHIPRFRAWPEATGEPKLQSFAGYKVGMTHVIMVDDTKNSLTQGMEISVPVTVIETPAIRVAAIRAYAEDSTGEKAIAEVWAADLDPELKRRIPIPAAGNQAEALENIGKLIEEGRVSDVRAVIYTLPKSLTGVPKKVPDIMESGISARDLGTKFEYSKTILGTLVSVTDVFKNGTLVDTAAITIGKGTQGPVKRWGIQLMKGKHSRQGSLRQVGTLGAFNPSRVSWRVPQMGQMGYHQRTEFNKRILKIGSDGEEVTPEGGFINYGLVRGDYILIKGSVPGPSKRLIRLRDPIRAKKADLGEPNILYISRESKQG

Entity 30 Entity 30 polymer

Description description	Large ribosomal subunit protein uL4
Molecular weight formula_weight	27516.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BE

MATAKTIDLTGKAVGEVELPAVFDADYRPDLIKKAVLAAQANRLQPYGPRLYSGMETSARGWGSGRGVSHVPRLVNSSRAARVPHAKGGRRAHPPKPEADRSEKVNTKERRYAIRSAIAATTDPTLVSLRGHIFEAELPIVAVNDLESLERTKQVIEFLEAAGLYEDVLRAKYGRHIRAGRGKLRGRKYKHKKSVLIVAGENTPILKAARNLSGVDVVTVDSLNAELLAPGTHAGRLTVWTESAIGKLEGAFQ

Entity 31 Entity 31 polymer

Description description	Large ribosomal subunit protein uL5
Molecular weight formula_weight	18398.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BF

MRTPIVEKVIVHMGVGESGQHLVNAEDILRNITGQEVVRCFAKRTLPAFSIKKNEPIGCKVTLRGQKAQEFLETALGIVEKTLNRSQFDSFGNVSFGIEEHTDFPGMRYDPNIGVFGMDVTVVLKRPGERICKRRIAARKIPAGHRVTVDDAIAFLNESYGVEVM

Entity 32 Entity 32 polymer

Description description	Large ribosomal subunit protein uL6
Molecular weight formula_weight	19530.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BG

MVKEIARTIEIPEGVSVSLAQDVFTATGPKGTVERKLWYPGIMIDVKDGEVVVDAEYARKEQKAMVGTFASHIRNLVKGVNEGFECKMSIVYAHFPMQVKVDGKTLIIGNFLGEKKPRFAKIIGETKVKVSGNDVTITGINKEDVGQTAANIEQKTKIKRFDPRIFQDGIYIVQKA

Entity 33 Entity 33 polymer

Description description	Large ribosomal subunit protein eL8
Molecular weight formula_weight	12741.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BH

MAQLAKFDVPEELTNKALEALELARDTGKIKKGTNEATKAIERGNAKLVLIAEDIEPAEIVAHIGPLSEEKKAPYIFIKNQKELGAASGLGVSCATVAIVDAGKAAEMVQDIAQKLEALK

Entity 34 Entity 34 polymer

Description description	Large ribosomal subunit protein uL16
Molecular weight formula_weight	19409.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BI

MVRKPGSMYRNVRQRSFTRRKYMGGVPGSQVIHYDMGDKANTSFPVKISLIVEEKCQIRHTALEAARITANRHLVADTGKMGFYMKLRVYPHEVIRENKQATGAGADRVSSGMRRAFGKNVGTAARVKPMQKIFTVAVEKQNFKAAKEALWHAGQKLPTPCRIVVDEGAELVQ

Entity 35 Entity 35 polymer

Description description	Large ribosomal subunit protein uL13
Molecular weight formula_weight	16085.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BJ

MLKMTVIDAKGLILGRLASSVAKQLLSGDEKVYIINAEQAIISGSRAATLREYRETRERGATEFGPYFPKRPDRILKRTIRGMLPYKRARGRDAMSRLKVYVGVPYELKGAETVTIPDADMRLLSSSRYVELGEVSQKMGSKF

Entity 36 Entity 36 polymer

Description description	Large ribosomal subunit protein uL14
Molecular weight formula_weight	14356.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BK

MKGMRSNIPRALNAGAQIACVDNTGAKVVEIISVKKYRGVKNRMPCAGIGDMCVVSVKKGTPEMRKQVLLAVVVRQKQEFRRPDGLHVSFEDNAMVITDEEGIPKGTDIKGPVAREVAERFPKIGTTASIIV

Entity 37 Entity 37 polymer

Description description	Large ribosomal subunit protein uL15
Molecular weight formula_weight	15129.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BL

MDTKKFRGSRTCGGGTHKNRRGAGNRGGRGKAGGCKHHFVRAMMRGYSYGKHGFKRPDEVSRDVSIVNVGELDELASYLVEEGLAEVKDGAYHINLENLGIEKVLGSGRVTKNLVVTSEEFSASAREKIENAGGSCIDAE

Entity 38 Entity 38 polymer

Description description	Large ribosomal subunit protein eL15
Molecular weight formula_weight	22650.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BM

MVKSFYGYVRDAWKNPDETYVNELRWERLQVWRKQGSVTRIERPTRIDRARSLGYKAKQGIVVVRVNVRRGGLGHVRPNRGRRTQKMGKNKVSGGMSIQRIAEVRADRRYPNLEVLNSYWVGEDGKHKWFEVILVDPHHPVIKSDKNLNWVCDPSSRGRATRGKTSAGRKGRGMATRGKGTEKTRPSIRAYKSRGK

Entity 39 Entity 39 polymer

Description description	Large ribosomal subunit protein uL18
Molecular weight formula_weight	19233.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BN

MATGPRYKVPFRRRREGRTNYHLRLKLLLSRQDRVVVRKSSRNVQIQLIAPTPDGDITYSSAVSNELAKYGYTGATGNTTAAYLTGLLFGLKSLQKGYEGGILDIGLQASSAGSRVYAALKGVVDSGFEIPCSPEVFPPDERIRGEHIAGYREESSDLPEQFEATKEKIFAEFS

Entity 40 Entity 40 polymer

Description description	Large ribosomal subunit protein eL18
Molecular weight formula_weight	13715.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BO

MGKKSLVKLTRKTNPRIVSLILTLKERANGDSAPIWKDIAKRLEAPSRNYAAVNISKINRHTAEDDVLLIPGKVLGAGLLDHPVTIAALTFSDSAFEKITEAGGKCLSLEEIMEANPKGSGIRIFR

Entity 41 Entity 41 polymer

Description description	Large ribosomal subunit protein eL19
Molecular weight formula_weight	17062.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BP

MSDLSNQRKLASKVLGCGLDRVWLNPEASEEIASAITREDIRGLIEEGTIKAKPVKGVSRGRARALAAKRKYGHCKGHGSRKGKKGARTPKKEQWIKKIRALRRRLKELRADGALDKSVYCRLYRKAKGGEYRSVSHLNSHLESEKLLKKE

Entity 42 Entity 42 polymer

Description description	Large ribosomal subunit protein eL20
Molecular weight formula_weight	6972.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BQ

MVMMKSFIVKGKFKAGSTWEKFTKKIESQNEKNATDKTYSIFGSKHGVKRSQVQIESVAEE

Entity 43 Entity 43 polymer

Description description	Large ribosomal subunit protein eL21
Molecular weight formula_weight	11063.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BR

MTNSHGEKRCTRYKLQKTVRERGISPVSRAIQEFEEGQMVHIDIDPSVQKGMPNPKFQGSTGKVIGQRGRSYVLEVRSGNAMKEVFSLPQHLKPQKY

Entity 44 Entity 44 polymer

Description description	Large ribosomal subunit protein uL22
Molecular weight formula_weight	16764.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BS

MARINYSINGDPETTSKAMGSELHISPKKSREVCCKIKGMKASEARKFLEDVIAMKQAVPFKKHHDGSGHRKGPMAAGKYPISASKEILKVLKNAESNAEYKGLEPANMYIIHAAIQRGRVIHGFMPRARGRATPKDTETVNIEMILSEVR

Entity 45 Entity 45 polymer

Description description	Large ribosomal subunit protein uL23
Molecular weight formula_weight	9447.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BT

MSSINYPFVTEKAMMLLDENKLQFIVDTRSNKKQILEDVEKMYGFKVKSVRTMTTMKGMKKAVLAFEEPEAAHEIATRIGLM

Entity 46 Entity 46 polymer

Description description	Large ribosomal subunit protein uL24
Molecular weight formula_weight	13075.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BU

MIAMVSKQPRKQRKARYAAPLHIRQKFMGARLSEALTKEYGTRSAAVITGDTVKVMRGDFKGTEGKVQSVSLMDGTITVDGVISTKVDGTEVPRPLNPSNVMITKLEMKDGRRASSIKK

Entity 47 Entity 47 polymer

Description description	Large ribosomal subunit protein eL24
Molecular weight formula_weight	7204.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BV

MEQRKCYFCGKMLEPGTGKLYVKKDGSTYFMCSSKCMSNFALGRLPRRTEWTEKGKIQLKKA

Entity 48 Entity 48 polymer

Description description	Large ribosomal subunit protein uL29
Molecular weight formula_weight	7622.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BW

MAILRTSEIRTMTIEERADELENLNNELVRERALTSAGGAPENPGRIGEIRRTIARIKTIQHELNEI

Entity 49 Entity 49 polymer

Description description	Large ribosomal subunit protein uL30
Molecular weight formula_weight	17627.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BX

MYAVVRLRGQVNVRYTIEDTMKMLRLHKVNHCVFVPENPHYKGMVQKVKDYVAYGKIDAKTLAEVLENRGRLEGDTRLTEEYIRENTDYDSIQAFAEAVIEGKSSLKDIPKLKPVFRLHPPRKGHAGIKRTVQQGGVLGNHDENINVLLHKMR

Entity 50 Entity 50 polymer

Description description	Large ribosomal subunit protein eL30
Molecular weight formula_weight	10316.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BY

MMKMKINVDKSLIKAVKTGKVIVGANRTIDAAANGSAKMVVLASNCPEDIKKKIQATDIPVLEYEGTSVELGPVCGKPFTIAAMAILDVGESDILAATA

Entity 51 Entity 51 polymer

Description description	Large ribosomal subunit protein eL31
Molecular weight formula_weight	10331.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BZ

MADDMVKEQIYTIPLREVRKVPAWKRANRAVIEVRGFLVRHMKTESVQVKLDKSINEHLWEKGCEKPPLSIRVRAVKFADGEVQAELAQ

Entity 52 Entity 52 polymer

Description description	Large ribosomal subunit protein eL32
Molecular weight formula_weight	17880.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ba

MIMMAEEFNEVEGTNEVEDINEVEGTSVSTLDMDPESRRLFNVRKVQKGKKPQFKRTCSHKFKRLDDNWRRPRGSQGKQRRKYVSKGALVQVGYGSPAAVKGLHPSGYSDVLISSIAELELVDPSYEAIRIAGTIGAQKKALILAKAEEAGIKVLNSGRSE

Entity 53 Entity 53 polymer

Description description	Large ribosomal subunit protein eL43
Molecular weight formula_weight	10557.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bb

MAKKFTKKGRISRSAGRFGPRYGRKDRKLVADLEERMRAPHVCTKCARPTVERIGTGIWKCSKCGHTFAGGTYIPYTSVGQTLLRTMKNIAEAK

Entity 54 Entity 54 polymer

Description description	Large ribosomal subunit protein eL37
Molecular weight formula_weight	6456.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bc

MSKGTSSMGKRQKRTHAKCRRCGSVSFNVHTKQCTSCGFGKTSRMRTYKWQAKCKY

Entity 55 Entity 55 polymer

Description description	Large ribosomal subunit protein eL39
Molecular weight formula_weight	6257.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bd

MSHNMKGQKKRLAKAHKQNTRVPVWVIVKTNRKVVSHPRRRHWRRRSLDVK

Entity 56 Entity 56 polymer

Description description	Large ribosomal subunit protein eL40
Molecular weight formula_weight	5964.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Be

MTKMARFPEAEERLLNKKICMKCNARNAIRATRCRKCGYGTLRVKSKESKGA

Entity 57 Entity 57 polymer

Description description	Large ribosomal subunit protein eL42
Molecular weight formula_weight	10873.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bf

MKIPKRFRTYCPFCKTHNEVVVERVKKGQASSMTHIARQKKRQEGIGNSGKFSKVPGGDKPTKRIWLRYRCTVCKKAHQRPCFRAKKFEFKE

Entity 58 Entity 58 polymer

Description description	Putative zinc finger domain-containing protein
Molecular weight formula_weight	6162.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AZ

MSSQKVEYCTSCGIRLVEKGYVKFPCPQCGAEIGRCISCRQQGNVYTCPKCGFKAP

Entity 59 Entity 59 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	51

Entity 60 Entity 60 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	9

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.92 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	91385

fit	/app/data/saxs_computation/o1/9o17/9o17.fit
pddf	/app/data/pr_computation/o1/9o17/9o17.pr.out
profile	/app/data/saxs_computation/o1/9o17/9o17.dat