9ou7

Methanosarcina acetivorans large (50S) subunit dimer

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Large ribosomal subunit protein uL2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL2_METAC
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain BC； PDBConstruct 1–238； UniProt 1–238 Author chain CC； PDBConstruct 1–238； UniProt 1–238

Large ribosomal subunit protein uL3

OrganismNot specified

UniProt Q8TRU7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL3_METAC
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain BD； PDBConstruct 1–337； UniProt 1–337 Author chain CD； PDBConstruct 1–337； UniProt 1–337

Large ribosomal subunit protein uL4

OrganismNot specified

UniProt Q8TRU6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL4_METAC
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain BE； PDBConstruct 1–253； UniProt 1–253 Author chain CE； PDBConstruct 1–253； UniProt 1–253

Large ribosomal subunit protein uL5

OrganismNot specified

UniProt Q8TRT4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL5_METAC
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain BF； PDBConstruct 1–165； UniProt 1–165 Author chain CF； PDBConstruct 1–165； UniProt 1–165

Large ribosomal subunit protein uL6

OrganismNot specified

UniProt Q8TRT1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL6_METAC
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain BG； PDBConstruct 1–176； UniProt 1–176 Author chain CG； PDBConstruct 1–176； UniProt 1–176

Large ribosomal subunit protein eL8

OrganismNot specified

UniProt Q8TQL9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL7A_METAC
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain BH； PDBConstruct 1–120； UniProt 1–120 Author chain CH； PDBConstruct 1–120； UniProt 1–120

Large ribosomal subunit protein uL16

OrganismNot specified

UniProt Q8TU90

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL10E_METAC
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain BI； PDBConstruct 1–173； UniProt 1–173 Author chain CI； PDBConstruct 1–173； UniProt 1–173

Large ribosomal subunit protein uL13

OrganismNot specified

UniProt Q8TT43

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL13_METAC
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain BJ； PDBConstruct 1–143； UniProt 1–143 Author chain CJ； PDBConstruct 1–143； UniProt 1–143

Large ribosomal subunit protein uL14

OrganismNot specified

UniProt Q8TRT7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL14_METAC
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain BK； PDBConstruct 1–132； UniProt 1–132 Author chain CK； PDBConstruct 1–132； UniProt 1–132

Large ribosomal subunit protein uL15

OrganismNot specified

UniProt Q8TRS5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15_METAC
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain BL； PDBConstruct 1–140； UniProt 1–140 Author chain CL； PDBConstruct 1–140； UniProt 1–140

Large ribosomal subunit protein eL15

OrganismNot specified

UniProt Q8TPX0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15E_METAC
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain BM； PDBConstruct 1–196； UniProt 1–196 Author chain CM； PDBConstruct 1–196； UniProt 1–196

Large ribosomal subunit protein uL18

OrganismNot specified

UniProt Q8TRS8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18_METAC
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain BN； PDBConstruct 1–174； UniProt 1–174 Author chain CN； PDBConstruct 1–174； UniProt 1–174

Large ribosomal subunit protein eL18

OrganismNot specified

UniProt Q8TT44

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18E_METAC
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain BO； PDBConstruct 1–126； UniProt 1–126 Author chain CO； PDBConstruct 1–126； UniProt 1–126

Large ribosomal subunit protein eL19

OrganismNot specified

UniProt A0A832W9G6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A832W9G6_9EURY
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain BP； PDBConstruct 1–151； UniProt 1–151 Author chain CP； PDBConstruct 1–151； UniProt 1–151

Large ribosomal subunit protein eL20

OrganismNot specified

UniProt Q8TIN5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18A_METAC
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain BQ； PDBConstruct 1–61； UniProt 1–61 Author chain CQ； PDBConstruct 1–61； UniProt 1–61

Large ribosomal subunit protein eL21

OrganismNot specified

UniProt Q8TQU3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL21_METAC
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain BR； PDBConstruct 1–97； UniProt 1–97 Author chain CR； PDBConstruct 1–97； UniProt 1–97

Large ribosomal subunit protein uL22

OrganismNot specified

UniProt Q8TRU2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL22_METAC
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain BS； PDBConstruct 1–151； UniProt 1–151 Author chain CS； PDBConstruct 1–151； UniProt 1–151

Large ribosomal subunit protein uL23

OrganismNot specified

UniProt Q8TRU5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL23_METAC
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain BT； PDBConstruct 1–82； UniProt 1–82 Author chain CT； PDBConstruct 1–82； UniProt 1–82

Large ribosomal subunit protein uL24

OrganismNot specified

UniProt Q8TRT6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24_METAC
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain BU； PDBConstruct 1–119； UniProt 1–119 Author chain CU； PDBConstruct 1–119； UniProt 1–119

Large ribosomal subunit protein eL24

OrganismNot specified

UniProt Q8TQL7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24E_METAC
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain BV； PDBConstruct 1–62； UniProt 1–62 Author chain CV； PDBConstruct 1–62； UniProt 1–62

Large ribosomal subunit protein uL29

OrganismNot specified

UniProt Q8TRU0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL29_METAC
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain BW； PDBConstruct 1–67； UniProt 1–67 Author chain CW； PDBConstruct 1–67； UniProt 1–67

Large ribosomal subunit protein uL30

OrganismNot specified

UniProt Q8TRS6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL30_METAC
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain BX； PDBConstruct 1–153； UniProt 1–153 Author chain CX； PDBConstruct 1–153； UniProt 1–153

Large ribosomal subunit protein eL30

OrganismNot specified

UniProt Q8TRB9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL30E_METAC
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain BY； PDBConstruct 1–99； UniProt 1–99 Author chain CY； PDBConstruct 1–99； UniProt 1–99

Large ribosomal subunit protein eL31

OrganismNot specified

UniProt Q8TIN3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL31_METAC
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain BZ； PDBConstruct 1–89； UniProt 1–89 Author chain CZ； PDBConstruct 1–89； UniProt 1–89

Large ribosomal subunit protein eL32

OrganismNot specified

UniProt A0A832W8Z7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A832W8Z7_9EURY
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain Ba； PDBConstruct 4–161； UniProt 1–158 Author chain Ca； PDBConstruct 4–161； UniProt 1–158

Large ribosomal subunit protein eL43

OrganismNot specified

UniProt A0A832SMV9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A832SMV9_9EURY
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain Bb； PDBConstruct 1–94； UniProt 1–94 Author chain Cb； PDBConstruct 1–94； UniProt 1–94

Large ribosomal subunit protein eL37

OrganismNot specified

UniProt Q8TL48

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL37_METAC
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain Bc； PDBConstruct 1–56； UniProt 1–56 Author chain Cc； PDBConstruct 1–56； UniProt 1–56

Large ribosomal subunit protein eL39

OrganismNot specified

UniProt Q8TIN2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL39_METAC
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain Bd； PDBConstruct 1–51； UniProt 1–51 Author chain Cd； PDBConstruct 1–51； UniProt 1–51

Large ribosomal subunit protein eL40

OrganismNot specified

UniProt Q8TJ19

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL40_METAC
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain Be； PDBConstruct 4–52； UniProt 1–49 Author chain Ce； PDBConstruct 4–52； UniProt 1–49

Large ribosomal subunit protein eL42

OrganismNot specified

UniProt A0A832W9V9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A832W9V9_9EURY
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain Bf； PDBConstruct 1–92； UniProt 1–92 Author chain Cf； PDBConstruct 1–92； UniProt 1–92

Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase

OrganismNot specified

UniProt A0A832VZC7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Elongation factor 2 × 2 （Q8TRC3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A832VZC7_9EURY
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain DA； PDBConstruct 1–538； UniProt 1–538 Author chain DB； PDBConstruct 1–538； UniProt 1–538

Elongation factor 2

OrganismNot specified

UniProt Q8TRC3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 64 RNA 4	23S rRNA × 2 5S rRNA × 2 Large ribosomal subunit protein uL2 × 2 （Q8TRU4） Large ribosomal subunit protein uL3 × 2 （Q8TRU7） Large ribosomal subunit protein uL4 × 2 （Q8TRU6） Large ribosomal subunit protein uL5 × 2 （Q8TRT4） Large ribosomal subunit protein uL6 × 2 （Q8TRT1） Large ribosomal subunit protein eL8 × 2 （Q8TQL9） Large ribosomal subunit protein uL16 × 2 （Q8TU90） Large ribosomal subunit protein uL13 × 2 （Q8TT43） Large ribosomal subunit protein uL14 × 2 （Q8TRT7） Large ribosomal subunit protein uL15 × 2 （Q8TRS5） Large ribosomal subunit protein eL15 × 2 （Q8TPX0） Large ribosomal subunit protein uL18 × 2 （Q8TRS8） Large ribosomal subunit protein eL18 × 2 （Q8TT44） Large ribosomal subunit protein eL19 × 2 （A0A832W9G6） Large ribosomal subunit protein eL20 × 2 （Q8TIN5） Large ribosomal subunit protein eL21 × 2 （Q8TQU3） Large ribosomal subunit protein uL22 × 2 （Q8TRU2） Large ribosomal subunit protein uL23 × 2 （Q8TRU5） Large ribosomal subunit protein uL24 × 2 （Q8TRT6） Large ribosomal subunit protein eL24 × 2 （Q8TQL7） Large ribosomal subunit protein uL29 × 2 （Q8TRU0） Large ribosomal subunit protein uL30 × 2 （Q8TRS6） Large ribosomal subunit protein eL30 × 2 （Q8TRB9） Large ribosomal subunit protein eL31 × 2 （Q8TIN3） Large ribosomal subunit protein eL32 × 2 （A0A832W8Z7） Large ribosomal subunit protein eL43 × 2 （A0A832SMV9） Large ribosomal subunit protein eL37 × 2 （Q8TL48） Large ribosomal subunit protein eL39 × 2 （Q8TIN2） Large ribosomal subunit protein eL40 × 2 （Q8TJ19） Large ribosomal subunit protein eL42 × 2 （A0A832W9V9） Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase × 2 （A0A832VZC7）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EF2_METAC
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain DC； PDBConstruct 1–730； UniProt 1–730 Author chain DD； PDBConstruct 1–730； UniProt 1–730

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ou7
Deposition date deposition_date	2025-05-28
Last revision last_revision	2025-09-24
Structure title title	Methanosarcina acetivorans large (50S) subunit dimer
Keywords keywords	Methanosarcina acetivorans, translation, large subunit dimer, 50S dimer, dimerization, hibernation, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ou7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ou7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ou7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	110.90 Å
Total Rg	111.00 Å
Atom count	272158
Residues	16426
Excluded volume	3268400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ou7__assembly_1__model_1`	68-meric （68）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (34)

Entity 1 Entity 1 polymer

Description description	23S rRNA
Molecular weight formula_weight	937667.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	BA,CA
Atom count atom_count	272158

AGGAAUUAUGCUAUCAGGUGGAUGGCUCGGCUCAAGAGCUUAUGAAGGACGUGCCAAGCUGCGAUAAGCCCGGGGUAGGUGCAUGGAGCCAAUGAACCCGGGAUUUCCGAAUGGGACCUCUCCGUAGUGAUCAUUCAUGAUCGGGAACGCUCCGAAUUGAAACAUCUCAGUAGGAGCGGGAAAAGAAAUCAAUUGAGAUGCCGUAAGUAACGGCGAGUGAAACCGGCACAGUUCAAACCGAAUCCCUUCGGGGACAUGUGGUGUUGUAGGGCUGUUCAAACGUCUGGCGGUAAAAUCGAACUUGCCUGGAACGGCAGACCAUAGAGUGUGACAGUCACUUAGAUGUACGCCAAAAGACCGGAACAUGUCCCUGAGUACCGUGCGUUGGAUAUCGUGCGUGAAUCUGGGGGGCACCAACCUCCAAAACUAAAUACUCCUUGAGACCGAUAGCGAAAUAGUAGGGUGACCGAACGCUGAAAAGUACCCCGAGAAGGGAGGUGCAAAGUGCCUGAAACCUGAUAGUGAUGGAACGAUACGGCAUGAAAGGAUCUCUGGCAUGAAGGAAUCAUUCGCGAGGAUGUAGUACGAAUGUCACUGCCAGUGUCGUAUCUUACGUUUUGAAGAACGGGCCAGGGAGUGUAUCUUGGUGGCAAUGGCUAACCUUUUAUCUGGGCAGCCGAAGCGAAAGCAACAUGUGCGCAGCCUUUUGGCGAGGCACGACGUAUACAAGUGCGUGGAGUCACCGGGGUACGACCCGAAGCCGGGUGAUCUAGGCGUGGGCAGGUUGAAGCGUGGCGAAAGCUACGUGGAGGACCGUAAACGGUAUUGAUCUGCAAAUCAUUCGUGUGACCUGCGUCUCGUAGUGAAAUGCUAAUCUAACCCGGCAUCCGCUGGUUCCUUCCGAAACAUGUCGCAGCAUGACCUGACUUGAGAUCGUCGGUGGAGUAGAGCACUGAUUGGCGAUUCCGGGGGAGAAAUCCCUCGCUCGCUUGUCAAACUCCAAACCCCCCGUCAUCCUAGAAAGUCGGAGUCCGGACUGCUGGGGUAAGCUUGUAGUCCGUAAGGGAGACAACCCAGCCCGUGGUUAAGGUCCCCAAGUGUCGACUAAGUGUUAAUACUAAAGGGCGUCCCAAGCCCCAGACAGCUGGAAGGUUAGCUUAGAAGCAGCUACCCUUCAAAGAGUGCGUAACAGCUCACCAGUCGAGGUUUGGGGCCCCGAAAAUUGACGGGGCUCAAGUCGACCACCGAUACCACGGAGUACCGCAAGGUAAUCUCGUAGGAAGGCGUUGUGUUCGGGUCGAAGCAGGGCUGUGAAGUCCUGUGGACCGUUCACAAACGAAAAUCCUGGUAAUAGUAGCAGCAAAGCAGGGUGAGACUCCCUGCCGCCGAAGGGGCCAGGUUUCCUCGGCAAUGUUCGUCAGCCGAGGGUUAGUCGGUCCUAAGACGUACCGUAAUUCGAGUACGCCGAAAGGGAAACAGGUUAAUAUUCCUGUACCAUUUAGCGUUUAGUCUGACGUCUCAGGGCAAGCCGAGCGGCGUCGUCGCGCCGUCUAAGCAGCGAACCCCGUGGAGAGCCGUAAUGGCGAGAAGCGGGCGAAUCUGUAAUGGCACAAGUCGGCUUCACCCCGGGACCCGUGAAAAGGACAGCUAAAUGUCCGUACCGAGAACUGACACAGGUGCCCCUAGCUGAAAAGGCUAAGGCGUGUCGGAGUAAUUCAGUUAAGGGAAUUCGGCAAAUUAGCUCCGUAACUUCGGGAUAAGGAGUGCCUGCUGUGUAGACAGCAGGUCGCAGUGACCAGGGGGCUCUAACUGUCUAAUACCAACAUAGGAGAUUGCAAACCCGUAAGGGCUAGUACAAUCUCUGAAUCCUGCUCAGUGCAGGUACCUGAAACCCCGGUUCAACGGGAAGAAGGGCCUGUAAACAGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGUCGCUUAAUUGGCGACUUGCAUGAAUGGAUCAAUGAGAGCCCUACUGUCCCUAACUGGAGUCCGGUGAAGCUUACAUUCUAGUGCACAGUCUAGAGACCUCUAGGGGGAAGUGAAGACCCCGUGGAGCUUUACUGCAGCCUGUCGUUGGGUUGUGGUUCUGGAUGUACAGUGUAGGUAGGAGGCAUCGAAGCGGGUGCGCCAGCAUUCGUGGAGCCGUCCUUGGGACACUACCCUUCCGGGACUACGACCCUAACUCUGAGAAGAGGACCCCGAUAGGUGGGCAGUUUGCCUGGGGCGGGACGCCCUUGAAAAGAUAUCAAGGGCGCGCAAUGGUUGACUCAAGCGGGUCGGAAACUCGCUGAAGAGUGCAAGAGCAUAAGUCAGCCUGACGUUAUUCAGCAUAGCAGUGGAUGACGAGACGAAAGUCGGCUCUAGCGAACUUUUGAGCCUCCUUGGUGGGGGCCAAAAAUGACAGAAAAGUUACCCCGGGGAUAAUUGAGUCGUUGCCGGCAAGAGUACAUAUCGACCCGGCAGCUUGCUACCUCGAUGUCGGUUCUUUCCAUCCUGGCCGUGCAGCAGCGGCCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGAUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUCGGUUACUAUCUACUAGAGGUGCCCGAGGUCUGCGGGUAAGCUGCUUUUAGUACGAGAGGAACCAAGCAGCGGCGCCACUGGUGUACCGGUUGUCUGACAAGGCAUCGCCGGGCAGCUACGCGCUCAGGAAUAAGAGCUGAAUGCAUCUAAGCUCGAACUCUGACCUAAAAAGAGACCUCUUUAAGGAUUCCGGUAAAAGACCGGUUUGAUAGAAACGGGAUGUAAGCACCAAGGCAACGAGGUGUUCAGUCCGCGUUUACUAACCAUUCGUUCCUUUCACUU

Entity 2 Entity 2 polymer

Description description	5S rRNA
Molecular weight formula_weight	41399.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	BB,CB

GAGUUUGGCGGCCAUAGCGGUAGGGCAACUCCUGUACCCAUCCCGAACACAGCAGAUAAGCCUGCCCGCGUUCCUUACUGUACUGAAGUGUGCGAGCCUUCGGGAACUCUGGAUCGCUGCCAAGCUCAC

Entity 3 Entity 3 polymer

Description description	Large ribosomal subunit protein uL2
Molecular weight formula_weight	25738.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BC,CC

MGKRLISQNRGRGTPTYRAPSHKYKADLRHPRVDENSSLRGEVVGIEHDPARSAPIAKVAFENGEELFLLASEGIAVGNIIECGDDAEVKPGNIVPIGNVPEGFFICNVESKPNDGGKFVRSSGVYATVVTHEATRTAVSMPSGNIKWLNPKCRAVVGIVAGSGRVDRPWLKAGKKYHKMKTRAAKYPRVSAVAMNPRDHPFGGGAWKHPGKPTTVSRNAPPGRKVGLIAARRTGMKR

Entity 4 Entity 4 polymer

Description description	Large ribosomal subunit protein uL3
Molecular weight formula_weight	36949.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BD,CD

MASIHRPKRGSLAFSPRKRAKSHIPRFRAWPEATGEPKLQSFAGYKVGMTHVIMVDDTKNSLTQGMEISVPVTVIETPAIRVAAIRAYAEDSTGEKAIAEVWAADLDPELKRRIPIPAAGNQAEALENIGKLIEEGRVSDVRAVIYTLPKSLTGVPKKVPDIMESGISARDLGTKFEYSKTILGTLVSVTDVFKNGTLVDTAAITIGKGTQGPVKRWGIQLMKGKHSRQGSLRQVGTLGAFNPSRVSWRVPQMGQMGYHQRTEFNKRILKIGSDGEEVTPEGGFINYGLVRGDYILIKGSVPGPSKRLIRLRDPIRAKKADLGEPNILYISRESKQG

Entity 5 Entity 5 polymer

Description description	Large ribosomal subunit protein uL4
Molecular weight formula_weight	27516.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BE,CE

MATAKTIDLTGKAVGEVELPAVFDADYRPDLIKKAVLAAQANRLQPYGPRLYSGMETSARGWGSGRGVSHVPRLVNSSRAARVPHAKGGRRAHPPKPEADRSEKVNTKERRYAIRSAIAATTDPTLVSLRGHIFEAELPIVAVNDLESLERTKQVIEFLEAAGLYEDVLRAKYGRHIRAGRGKLRGRKYKHKKSVLIVAGENTPILKAARNLSGVDVVTVDSLNAELLAPGTHAGRLTVWTESAIGKLEGAFQ

Entity 6 Entity 6 polymer

Description description	Large ribosomal subunit protein uL5
Molecular weight formula_weight	18398.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BF,CF

MRTPIVEKVIVHMGVGESGQHLVNAEDILRNITGQEVVRCFAKRTLPAFSIKKNEPIGCKVTLRGQKAQEFLETALGIVEKTLNRSQFDSFGNVSFGIEEHTDFPGMRYDPNIGVFGMDVTVVLKRPGERICKRRIAARKIPAGHRVTVDDAIAFLNESYGVEVM

Entity 7 Entity 7 polymer

Description description	Large ribosomal subunit protein uL6
Molecular weight formula_weight	19530.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BG,CG

MVKEIARTIEIPEGVSVSLAQDVFTATGPKGTVERKLWYPGIMIDVKDGEVVVDAEYARKEQKAMVGTFASHIRNLVKGVNEGFECKMSIVYAHFPMQVKVDGKTLIIGNFLGEKKPRFAKIIGETKVKVSGNDVTITGINKEDVGQTAANIEQKTKIKRFDPRIFQDGIYIVQKA

Entity 8 Entity 8 polymer

Description description	Large ribosomal subunit protein eL8
Molecular weight formula_weight	12741.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BH,CH

MAQLAKFDVPEELTNKALEALELARDTGKIKKGTNEATKAIERGNAKLVLIAEDIEPAEIVAHIGPLSEEKKAPYIFIKNQKELGAASGLGVSCATVAIVDAGKAAEMVQDIAQKLEALK

Entity 9 Entity 9 polymer

Description description	Large ribosomal subunit protein uL16
Molecular weight formula_weight	19409.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BI,CI

MVRKPGSMYRNVRQRSFTRRKYMGGVPGSQVIHYDMGDKANTSFPVKISLIVEEKCQIRHTALEAARITANRHLVADTGKMGFYMKLRVYPHEVIRENKQATGAGADRVSSGMRRAFGKNVGTAARVKPMQKIFTVAVEKQNFKAAKEALWHAGQKLPTPCRIVVDEGAELVQ

Entity 10 Entity 10 polymer

Description description	Large ribosomal subunit protein uL13
Molecular weight formula_weight	16085.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BJ,CJ

MLKMTVIDAKGLILGRLASSVAKQLLSGDEKVYIINAEQAIISGSRAATLREYRETRERGATEFGPYFPKRPDRILKRTIRGMLPYKRARGRDAMSRLKVYVGVPYELKGAETVTIPDADMRLLSSSRYVELGEVSQKMGSKF

Entity 11 Entity 11 polymer

Description description	Large ribosomal subunit protein uL14
Molecular weight formula_weight	14356.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BK,CK

MKGMRSNIPRALNAGAQIACVDNTGAKVVEIISVKKYRGVKNRMPCAGIGDMCVVSVKKGTPEMRKQVLLAVVVRQKQEFRRPDGLHVSFEDNAMVITDEEGIPKGTDIKGPVAREVAERFPKIGTTASIIV

Entity 12 Entity 12 polymer

Description description	Large ribosomal subunit protein uL15
Molecular weight formula_weight	15129.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BL,CL

MDTKKFRGSRTCGGGTHKNRRGAGNRGGRGKAGGCKHHFVRAMMRGYSYGKHGFKRPDEVSRDVSIVNVGELDELASYLVEEGLAEVKDGAYHINLENLGIEKVLGSGRVTKNLVVTSEEFSASAREKIENAGGSCIDAE

Entity 13 Entity 13 polymer

Description description	Large ribosomal subunit protein eL15
Molecular weight formula_weight	22650.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BM,CM

MVKSFYGYVRDAWKNPDETYVNELRWERLQVWRKQGSVTRIERPTRIDRARSLGYKAKQGIVVVRVNVRRGGLGHVRPNRGRRTQKMGKNKVSGGMSIQRIAEVRADRRYPNLEVLNSYWVGEDGKHKWFEVILVDPHHPVIKSDKNLNWVCDPSSRGRATRGKTSAGRKGRGMATRGKGTEKTRPSIRAYKSRGK

Entity 14 Entity 14 polymer

Description description	Large ribosomal subunit protein uL18
Molecular weight formula_weight	19233.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BN,CN

MATGPRYKVPFRRRREGRTNYHLRLKLLLSRQDRVVVRKSSRNVQIQLIAPTPDGDITYSSAVSNELAKYGYTGATGNTTAAYLTGLLFGLKSLQKGYEGGILDIGLQASSAGSRVYAALKGVVDSGFEIPCSPEVFPPDERIRGEHIAGYREESSDLPEQFEATKEKIFAEFS

Entity 15 Entity 15 polymer

Description description	Large ribosomal subunit protein eL18
Molecular weight formula_weight	13715.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BO,CO

MGKKSLVKLTRKTNPRIVSLILTLKERANGDSAPIWKDIAKRLEAPSRNYAAVNISKINRHTAEDDVLLIPGKVLGAGLLDHPVTIAALTFSDSAFEKITEAGGKCLSLEEIMEANPKGSGIRIFR

Entity 16 Entity 16 polymer

Description description	Large ribosomal subunit protein eL19
Molecular weight formula_weight	17062.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BP,CP

MSDLSNQRKLASKVLGCGLDRVWLNPEASEEIASAITREDIRGLIEEGTIKAKPVKGVSRGRARALAAKRKYGHCKGHGSRKGKKGARTPKKEQWIKKIRALRRRLKELRADGALDKSVYCRLYRKAKGGEYRSVSHLNSHLESEKLLKKE

Entity 17 Entity 17 polymer

Description description	Large ribosomal subunit protein eL20
Molecular weight formula_weight	6972.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BQ,CQ

MVMMKSFIVKGKFKAGSTWEKFTKKIESQNEKNATDKTYSIFGSKHGVKRSQVQIESVAEE

Entity 18 Entity 18 polymer

Description description	Large ribosomal subunit protein eL21
Molecular weight formula_weight	11063.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BR,CR

MTNSHGEKRCTRYKLQKTVRERGISPVSRAIQEFEEGQMVHIDIDPSVQKGMPNPKFQGSTGKVIGQRGRSYVLEVRSGNAMKEVFSLPQHLKPQKY

Entity 19 Entity 19 polymer

Description description	Large ribosomal subunit protein uL22
Molecular weight formula_weight	16764.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BS,CS

MARINYSINGDPETTSKAMGSELHISPKKSREVCCKIKGMKASEARKFLEDVIAMKQAVPFKKHHDGSGHRKGPMAAGKYPISASKEILKVLKNAESNAEYKGLEPANMYIIHAAIQRGRVIHGFMPRARGRATPKDTETVNIEMILSEVR

Entity 20 Entity 20 polymer

Description description	Large ribosomal subunit protein uL23
Molecular weight formula_weight	9447.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BT,CT

MSSINYPFVTEKAMMLLDENKLQFIVDTRSNKKQILEDVEKMYGFKVKSVRTMTTMKGMKKAVLAFEEPEAAHEIATRIGLM

Entity 21 Entity 21 polymer

Description description	Large ribosomal subunit protein uL24
Molecular weight formula_weight	13075.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BU,CU

MIAMVSKQPRKQRKARYAAPLHIRQKFMGARLSEALTKEYGTRSAAVITGDTVKVMRGDFKGTEGKVQSVSLMDGTITVDGVISTKVDGTEVPRPLNPSNVMITKLEMKDGRRASSIKK

Entity 22 Entity 22 polymer

Description description	Large ribosomal subunit protein eL24
Molecular weight formula_weight	7204.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BV,CV

MEQRKCYFCGKMLEPGTGKLYVKKDGSTYFMCSSKCMSNFALGRLPRRTEWTEKGKIQLKKA

Entity 23 Entity 23 polymer

Description description	Large ribosomal subunit protein uL29
Molecular weight formula_weight	7622.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BW,CW

MAILRTSEIRTMTIEERADELENLNNELVRERALTSAGGAPENPGRIGEIRRTIARIKTIQHELNEI

Entity 24 Entity 24 polymer

Description description	Large ribosomal subunit protein uL30
Molecular weight formula_weight	17627.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BX,CX

MYAVVRLRGQVNVRYTIEDTMKMLRLHKVNHCVFVPENPHYKGMVQKVKDYVAYGKIDAKTLAEVLENRGRLEGDTRLTEEYIRENTDYDSIQAFAEAVIEGKSSLKDIPKLKPVFRLHPPRKGHAGIKRTVQQGGVLGNHDENINVLLHKMR

Entity 25 Entity 25 polymer

Description description	Large ribosomal subunit protein eL30
Molecular weight formula_weight	10316.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BY,CY

MMKMKINVDKSLIKAVKTGKVIVGANRTIDAAANGSAKMVVLASNCPEDIKKKIQATDIPVLEYEGTSVELGPVCGKPFTIAAMAILDVGESDILAATA

Entity 26 Entity 26 polymer

Description description	Large ribosomal subunit protein eL31
Molecular weight formula_weight	10331.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BZ,CZ

MADDMVKEQIYTIPLREVRKVPAWKRANRAVIEVRGFLVRHMKTESVQVKLDKSINEHLWEKGCEKPPLSIRVRAVKFADGEVQAELAQ

Entity 27 Entity 27 polymer

Description description	Large ribosomal subunit protein eL32
Molecular weight formula_weight	17880.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ba,Ca

MIMMAEEFNEVEGTNEVEDINEVEGTSVSTLDMDPESRRLFNVRKVQKGKKPQFKRTCSHKFKRLDDNWRRPRGSQGKQRRKYVSKGALVQVGYGSPAAVKGLHPSGYSDVLISSIAELELVDPSYEAIRIAGTIGAQKKALILAKAEEAGIKVLNSGRSE

Entity 28 Entity 28 polymer

Description description	Large ribosomal subunit protein eL43
Molecular weight formula_weight	10557.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bb,Cb

MAKKFTKKGRISRSAGRFGPRYGRKDRKLVADLEERMRAPHVCTKCARPTVERIGTGIWKCSKCGHTFAGGTYIPYTSVGQTLLRTMKNIAEAK

Entity 29 Entity 29 polymer

Description description	Large ribosomal subunit protein eL37
Molecular weight formula_weight	6456.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bc,Cc

MSKGTSSMGKRQKRTHAKCRRCGSVSFNVHTKQCTSCGFGKTSRMRTYKWQAKCKY

Entity 30 Entity 30 polymer

Description description	Large ribosomal subunit protein eL39
Molecular weight formula_weight	6257.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bd,Cd

MSHNMKGQKKRLAKAHKQNTRVPVWVIVKTNRKVVSHPRRRHWRRRSLDVK

Entity 31 Entity 31 polymer

Description description	Large ribosomal subunit protein eL40
Molecular weight formula_weight	5964.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Be,Ce

MTKMARFPEAEERLLNKKICMKCNARNAIRATRCRKCGYGTLRVKSKESKGA

Entity 32 Entity 32 polymer

Description description	Large ribosomal subunit protein eL42
Molecular weight formula_weight	10873.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bf,Cf

MKIPKRFRTYCPFCKTHNEVVVERVKKGQASSMTHIARQKKRQEGIGNSGKFSKVPGGDKPTKRIWLRYRCTVCKKAHQRPCFRAKKFEFKE

Entity 33 Entity 33 polymer

Description description	Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
Molecular weight formula_weight	59386.5 kDa
EC 编号 ec_number	2.1.2.3,3.5.4.10
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	DA,DB

MVKRALLSVSDKTGITEFARGLEALGVKIISTGGTAKILRDAGIEVTDVSEVTGYPEMMGGRVKTLHPRIHGGLLCLRESKEQMEEAEKEDISLIDLVAVNLYPFEITISKEGVELEEAIENIDIGGPTLLRSAAKNYRSVTVISNPSDYGHVLKELRSSGIISDKTRANLAVKAFRHTADYDAAIDTYLSRTLLGEEVLRLKFTDGVKLRYGENWHQSACFYKDPGIEGPSLAKAVQLHGKELSYNNYVDADNALQTVKELGNASPAVAIVKHNNPCGLATGDTLLQALQAAWDGDPISAYGSIICTNETFDLEAATFLNGKFIEIILAPDFKPDALEYLKNKSENLRLLKLPELREVFGTEYTYKYVIGGMLKQSRDIGIYDKWESVTEVSYPEGKRTLSEFCLKACKATKSNAVILAHEYEPGYFMVLGMGAGQPNRVDSIRKLAATKAVENLKVIYEREQPAVAFEEYCQKILSECVMASDAFFPFDDSVVHAAENNIRYIVSPGGSIRDNEVIATANRLGIAMVFTGMRHFLH

Entity 34 Entity 34 polymer

Description description	Elongation factor 2
Molecular weight formula_weight	80658.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	DC,DD

MGRRKKMVERVTTLMNDPQRIRNIGIVAHIDHGKTTLSDNLLAGAGMISKELAGKQLFMDSDEEEQARGITIDSSNVSMVHTFDNEDYLINLIDTPGHVDFGGDVTRAMRAVDGAVVVVDAVEGTMPQTETVLRQALREHVRPVLFVNKVDRLINELQVDSQEMQIRLGKVIDHVNKLIKNMNPEKFKAGWKVDAAAGTVAFGSALYNWAISVPMMKKTGVSFKDVYDYCKAGDMKSLAEKCPLHEAVLDMVIHFLPNPIEAQKGRVKVIWHGDENTEIGKAMTHANAEGDLAFMVTDISVDPHAGEVATGRLFSGSLTRGMEVFTSGSARKSRVQQVGIFMGPERLEVDKIPAGNIAAVTGLKEAIVGSTVTTLDGMTPFESIRHVSEPVVTVAVEAKHTKDLPKLIEVLRQVAKEDPTLQITLDEETGEHLMAGMGELHLEVIAHRIERDKNVEITTSKPIVVYRETIKKKTEPIEGKSPNRHNRFYIYAEPLDTEIVSAIKEGEVSMNLPELERRQKLIDLGMEKEEAKGIVGIFNSNIFIDMTKGIQYLNETMELVLDGFEEVMRAGPLTREPVANVKCVLVDAKLHEDAIHRGPAQIIPAARQAIQAGMLMAEDSLLEPYQKVFVQVPQLLMGGATKELQGRRGIILNMTTEGDLAIIEARVPVAEMFGFAGEIRSATEGRAMWSTEFGGFDVVPSSILNDIVGQIRERKGLKKELPKASDFLSM

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.51 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	15110

Methanosarcina acetivorans large (50S) subunit dimer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Large ribosomal subunit protein uL2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein eL8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL16

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL15

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer