SAXSdb — 9ozc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tyrosine-protein kinase receptor

Gallus gallus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 4 其他Polymer 4	Protein NEL × 2 （Q90827） NELL2-interacting cell ontogeny regulator 1 × 1 （Q5BLP8） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1NQL9_CHICK
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–2311； UniProt 1–2311

Protein NEL

Gallus gallus

UniProt Q90827

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 4 其他Polymer 4	Tyrosine-protein kinase receptor × 1 （F1NQL9） NELL2-interacting cell ontogeny regulator 1 × 1 （Q5BLP8） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NEL_CHICK
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–816； UniProt 1–816 Author chain C； PDBConstruct 1–816； UniProt 1–816

NELL2-interacting cell ontogeny regulator 1

Homo sapiens

UniProt Q5BLP8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 4 其他Polymer 4	Tyrosine-protein kinase receptor × 1 （F1NQL9） Protein NEL × 2 （Q90827） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NICOL_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–95； UniProt 1–95

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ozc
Deposition date deposition_date	2025-06-05
Structure title title	Cryo-EM structure of 1:2:1 ROS1/NEL/NICOL holo-complex, conformation 1.
Keywords keywords	ROS1, NEL, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ozc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ozc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ozc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	115.10 Å
Total Rg	114.60 Å
Atom count	50924
Residues	3250
Excluded volume	461050 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ozc__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Tyrosine-protein kinase receptor
Molecular weight formula_weight	261174.8 kDa
EC 编号 ec_number	2.7.10.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	50924

MRNACLLLNRLGAFYFIWISAAYCSFSKNCQDLCTSNLEGELGIANLCNVSDINVACTQGCQFWNATEQVNCPLKCNKTYTRECETVSCKFGCSRAEDAYGVEAQNCLNKPGAPFASSIGSHNITLGWKPANISEVKYIIQWKFHQLPGDWRYTEVVSETSYTVKDLQAFTEYEFRVVWIITSQLQLHSPPSPSYRTHASGVPTTAPIIKDIQSSSPNTVEVSWFPPLFPNGLIVGYNLVLTSENHELLRASRGHSFQFYSTFPNSTYRFSIVAVNEAGAGPPAEANITTPESKVKEKAKWLFLSRNQSLRKRYMEHFLEAAHCLQNGIIHHNITGISVNVYQQVVYFSEGNSIWVKGVVDMSDVSDLTLFYTGWGNITSISVDWLYQRMYFVMNEKIHVCQLENCTAAEDITPPYVTSPRKIVADPYNGYIFCLLEDGIYRANLPLFPDTASAASLVVKSHTLRDFMINFQSKRLIFFNKTEQAFVSGFLDGSEFHTLRAHVPLDDMESFVYEDNIFTVTDGRAVFHEEISQVGSSSFNEYVVDCSLEYPEYFGFGNLLFYAASTQPYPLPTLPRLVTVLFGSDQAVISWSPPEYTIGTSRSAWQNWTYDVKVSSQSTFEEEWVVSNITDTRFAVKNLVSFTEYEMSVRAVSPAGEGPWSEPFRGMTFEEAEEEPYILAVGAEGLWKQRLDSYGPGEFLYPHIRNISDLDWYNDTLYWSNSMGKVQTWSMNKKEGTTENSYVPDIKNARMLAFDWLGQCLYWAGKANTIYRKSLLGDHMDVVAHVVYVVKDLAVDSVNGYLYWATTYTVESARLNGEEYLILQEHLQFSGKQVVGLALDLTSGFLYWLVQDGLCLNLYRISICKESCGNIMVTEISAWSVSEVSQNALQYYSGRLFWINRLKFITTQELNQSISIPFSEPAEFAAFTLVHTSLKPLPGNFSFTPKVIPSSVPESSFKIKGNSSSFHIIWNASTDVQWGTVFYCVGSNALQMRTLESERCLHPHDLTVPSYKVDWLEPFTLFDFSVTPYTYWGKAPTTSVYLRAPEGVPSAPANPRIYVLHSNTHEGEEKVLVELRWDKPERDNGVLTQFRVYYQLLYESGAADTLMEWNVSDVKPTALLFSIRDVHPRLTVRFQVQAFTSVGPGPMSDVAQRNSSDIFPVPTLITFSSNKLFLTDIDSNHTIWEVLTNRNIKDICYTADDDKVYYILEDSLFLLNVQSTSESQLFEDVFLRNVTAITVDWIARHLFVAMKTSWNETQVFFIDLELKTKSLKALNIQLGKRNSTISSLLSYPFLSRLYWIEELDYGSRMFYYDILNNTMYHILGYESVEEKMRNYCNCNVAEAELGRPISIDVTDIKKPQLLFIRGRDEIWASDVDGCHCWRITKIPSFQGTKIGSLTVDKQFIYWTIEKKEYTEICLADKESTRHSLQRKANHELKILAYSSAMQSYPDKKCLTPLLDTEKPTILDTTNTSFTLSLPSVTTQQLCPSISQPTPTYLVFFREITSNHENSTYHFSTLLQKTLEIQEPIAVINNLKPFSSYAIQVAVKNYYSNQNQLAVGRETISTTLYGVPEGVDSIKTVVLSDTTINISWSEPLEPNGPLESIRYQISVNLLSLFPEAPLRKSEFPNGTLSWSVSDLQSGTNNLFKVLAFHPNENWFSESVPVIAKTFETPLSPSNIIPRNTSFQLEWRAPLHINGTSFWFELRKWQTRSDWFSPASTTCTVGPVYTCNLTGTLPSANYLVRATVVYVTGMKSTSSPTSFKTTAGVPSKPGTPKRAEDSKNSVQWEKAEDNGSNLTYYILESRKQSGNTNKVKSLWVVVYNGSCDSICTWKAENLEGTFQFRAAAANMLGLGEYSDTSKDIVLAKDTVTSPDITAIVAVIGAVVLGLTIIILFGFVWHQRWKSRKPASTGQIVLVKEDKELAQLRGMAETVGLANACYAVSTLPSQAEIESLPAFPRDKLNLHKLLGSGAFGEVYEGTALDILADGSGESRVAVKTLKRGATDQEKSEFLKEAHLMSKFDHPHILKLLGVCLLNEPQYLILELMEGGDLLSYLRGARKQKFQSPLLTLTDLLDICLDICKGCVYLEKMRFIHRDLAARNCLVSEKQYGSCSRVVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLIDGVFTNHSDVWAFGVLVWETLTLGQQPYPGLSNIEVLHHVRSGGRLESPNNCPDDIRDLMTRCWAQDPHNRPTFFYIQHKLQEIRHSPLCFSYFLGDKESVAGFINQAFEDIDVPPADSDSILSTTLMEARDQEGLNYLVVVKESNQDQGSISSAELTSV

Source Source

Source organism organism	Gallus gallus
Common name common_name	chicken
NCBI taxonomy ID ncbi_taxonomy_id	9031
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Protein NEL
Molecular weight formula_weight	91071.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C

MESGCGLGTLCLLLCLGPVVGFGVDPSLQIDVLSELGLPGYAAGVRQVPGLHNGSKAFLFPDTSRSVKASPETAEIFFQKLRNKYEFTILVTLKQAHLNSGVIFSIHHLDHRYLELESSGHRNEIRLHYRTGSHRSHTEVFPYILADDKWHRLSLAISASHLILHVDCNKIYERVVEKPFMDLPVGTTFWLGQRNNAHGYFKGIMQDVQLLVMPQGFISQCPDLNRTCPTCNDFHGLVQKIMELQDILAKTSAKLSQAEQRMNKLDQCYCERTCTMKGMTYREFESWTDGCKNCTCMNGTVQCEALICSLSDCPPNSALSYVDGKCCKECQSVCIFEGRTYFEGQRETVYSSSGDCVLFECKDHKMQRIPKDSCATLNCPESQQIPLSHSCCKICKGHDFCTEGHNCMEHSVCRNLDDRAVCSCRDGFRALREDNAYCEDVDECAEGQHYCRENTMCVNTPGSFMCICKTGYIRIDDYSCTEHDECVTNQHNCDENALCFNTVGGHNCVCKLGYTGNGTVCKAFCKDGCRNGGACIASNVCACPQGFTGPSCETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESCEDIDECATGRHSCANDTVCFNLDGGYDCRCPHGKNCTGDCIHEDKIKHNGQIWVLENDRCSVCSCQSGYVMCRRMVCDCENPTVDLFCCPECDPRLSSQCLHQSGELSYNSGDSWIQNCQQCRCLQGEVDCWPLPCPEVDCEFSVLPENECCPRCVTDPCQADTIRNDITKTCLDETNVVRFTGSSWIKHGTECTLCQCKNGHVCCSVDPQCLQEL

Source Source

Source organism organism	Gallus gallus
Common name common_name	chicken
NCBI taxonomy ID ncbi_taxonomy_id	9031
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	NELL2-interacting cell ontogeny regulator 1
Molecular weight formula_weight	10182.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAPPPACRSPMSPPPPPLLLLLLSLALLGARARAEPAGSAVPAQSRPCVDCHAFEFMQRALQDLRKTACSLDARTETLLLQAERRALCACWPAGH

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	3

Entity 5 Entity 5 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	28

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.000 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	4.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	17461

Cryo-EM structure of 1:2:1 ROS1/NEL/NICOL holo-complex, conformation 1.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tyrosine-protein kinase receptor

State in the Current Structure

Other States of the Same Protein in the Database

Protein NEL

State in the Current Structure

Other States of the Same Protein in the Database

NELL2-interacting cell ontogeny regulator 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ozc__assembly_1__model_1

9ozc__assembly_1__model_1 | I(q)

9ozc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 branched

Entity 5 Entity 5 branched

Entity 6 Entity 6 non-polymer

7. Citations (1)

Cryo-EM structure of 1:2:1 ROS1/NEL/NICOL holo-complex, conformation 1.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tyrosine-protein kinase receptor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein NEL

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NELL2-interacting cell ontogeny regulator 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ozc__assembly_1__model_1

9ozc__assembly_1__model_1 | I(q)

9ozc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 branched

Entity 5 Entity 5 branched

Entity 6 Entity 6 non-polymer

7. Citations (1)