9pzm

Augmin V junction with NEDD1 (WD)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

AUGMIN subunit 2

Arabidopsis thaliana

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	AUGMIN subunit 3 × 1 （Q0WQE7） AUGMIN subunit 5 × 1 （Q9FMB4） AUGMIN subunit 6 × 1 （Q94BP7） AUGMIN subunit 7 × 1 （Q0WTP1） AUGMIN subunit 8 × 1 （Q9SUH5） Protein NEDD1 × 1 （B3H5K9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AUG2_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–148； UniProt 22–169

AUGMIN subunit 3

Arabidopsis thaliana

UniProt Q0WQE7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	AUGMIN subunit 2 × 1 （O48767） AUGMIN subunit 5 × 1 （Q9FMB4） AUGMIN subunit 6 × 1 （Q94BP7） AUGMIN subunit 7 × 1 （Q0WTP1） AUGMIN subunit 8 × 1 （Q9SUH5） Protein NEDD1 × 1 （B3H5K9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AUG3_ARATH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–617； UniProt 1–617

AUGMIN subunit 5

Arabidopsis thaliana

UniProt Q9FMB4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	AUGMIN subunit 2 × 1 （O48767） AUGMIN subunit 3 × 1 （Q0WQE7） AUGMIN subunit 6 × 1 （Q94BP7） AUGMIN subunit 7 × 1 （Q0WTP1） AUGMIN subunit 8 × 1 （Q9SUH5） Protein NEDD1 × 1 （B3H5K9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AUG5_ARATH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–777； UniProt 1–796

AUGMIN subunit 6

Arabidopsis thaliana

UniProt Q94BP7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	AUGMIN subunit 2 × 1 （O48767） AUGMIN subunit 3 × 1 （Q0WQE7） AUGMIN subunit 5 × 1 （Q9FMB4） AUGMIN subunit 7 × 1 （Q0WTP1） AUGMIN subunit 8 × 1 （Q9SUH5） Protein NEDD1 × 1 （B3H5K9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AUG6_ARATH
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 1–328； UniProt 1–328

AUGMIN subunit 7

Arabidopsis thaliana

UniProt Q0WTP1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	AUGMIN subunit 2 × 1 （O48767） AUGMIN subunit 3 × 1 （Q0WQE7） AUGMIN subunit 5 × 1 （Q9FMB4） AUGMIN subunit 6 × 1 （Q94BP7） AUGMIN subunit 8 × 1 （Q9SUH5） Protein NEDD1 × 1 （B3H5K9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AUG7_ARATH
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–329； UniProt 1–329

AUGMIN subunit 8

Arabidopsis thaliana

UniProt Q9SUH5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	AUGMIN subunit 2 × 1 （O48767） AUGMIN subunit 3 × 1 （Q0WQE7） AUGMIN subunit 5 × 1 （Q9FMB4） AUGMIN subunit 6 × 1 （Q94BP7） AUGMIN subunit 7 × 1 （Q0WTP1） Protein NEDD1 × 1 （B3H5K9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AUG8_ARATH
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H； PDBConstruct 1–165； UniProt 429–593

Protein NEDD1

Arabidopsis thaliana

UniProt B3H5K9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	AUGMIN subunit 2 × 1 （O48767） AUGMIN subunit 3 × 1 （Q0WQE7） AUGMIN subunit 5 × 1 （Q9FMB4） AUGMIN subunit 6 × 1 （Q94BP7） AUGMIN subunit 7 × 1 （Q0WTP1） AUGMIN subunit 8 × 1 （Q9SUH5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NEDD1_ARATH
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–310； UniProt 10–319

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9pzm
Deposition date deposition_date	2025-08-11
Structure title title	Augmin V junction with NEDD1 (WD)
Keywords keywords	Microtubule nucleator, PLANT PROTEIN; PLANT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9pzm__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9pzm__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9pzm__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	65.86 Å
Rg (electron density)	68.01 Å
Total Rg	67.49 Å
Atom count	14092
Residues	1785
Excluded volume	249670 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9pzm__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	AUGMIN subunit 2
Molecular weight formula_weight	16952.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	14092

SDALSIASDLGFAVAPPPSQEELQSFASSNGERGDDLIRVLRELSVVQRKIADLQVELQGRKDDKNVAHLTHVGEMQKKIETLSRITQILKDVIQNKDRIIARLQQPYSLDCIPVEAEYQKQFSELLMKAASDYGALTASVSDFQWSQSMQG

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	AUGMIN subunit 3
Molecular weight formula_weight	69809.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSSARLCSLVAELGYEGAGKLDPDSFEWPFQYDDARPILDWICSSLRPSNVLSLAELSLYEQFQRDGKLLEGDDLDQAYDSISAFSSRRNNQEAVFGAEESIKEVRDATLAHKAEALELQRQLRRLQTQYDLLTGQSSALIQGRRARVAATSAVSGQITAIEDSLSARNLQMNGVLGRLASTSQELAHYHSGEEDGIYLAYSDFHAYLAGDSACTKELNQWFAKQLDTGPYRLVAEEGKSKCSWVSLDDTSNMLRDLEKSQHQRVAELQRLRSIFGTSERQWIEAQVENAKQQAILLTLKSQVTSVEAHIHFDLHSLRRKHADLVEEISTLYQKEEKLLSETIPELCWELAQLQDTYILQGDYDLKVMRQELYISKQKVFINHLVNQLARHQFLKLACQLEKKNMLGAFSLLKVIESELQGYLSATRSRVGRCSALIQAASDVQEQGAVDDRDSFLHGVRDLLSIHSNTQAGLSTYVSAPAIIQQIVALQSDLSSLQSDLENSLPDDRNRCINELCTHIQNLQQLLFASSTTAQPILTPWPLMKELDEMGKINSKLSTAVEEVTLEHRNKREIVKHHAKDVELQRRVFVDFFCNPERLRNQVRELNALVRARQASSS

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	AUGMIN subunit 5
Molecular weight formula_weight	87231.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MQSLSSSAPTPEAILEWLQKEMGYRQLGPYNGSSKSHVPSIDAIRKICRGNMIPIWNFLINRVKSEKTVERIRRNITVHGGSSNASIGSSVNPGKEESKSKGRRKDKTVTGESSSYAEDREAALQERELAAKEVERLRNIVRRQRKDLKARMLEVSREEAERKRMLDERANYRHKQALLEAYDQQCDEATRIFAEYHKRLQVYVNQANDAQRSVNSSNEVLSSLSANSEREAVYSTVKGTKSADDVILMETTRERNIRIVCDLLASRMIERIRNSFPAYEGNGICSLPELETAKLGFEYDGEITDEMKTVIVNSLRGPPLLLQAIAAYTLRIKTLISREMEKIDVRADAEMLRYKFENNRVTDNSSSDVSSPSNNQLLERQKAHVQQFLATEDALNKAAEARDLCHKFINRLHGSADTATHSFVGGTTQSGSNLRQFELDVWGKEREAAGLRASLNTLLSEIQRLNKLCAERKEAEDSLKKKWKKIEEFDARRSELETIYTTLLKANMDAVAFWNQQPLAAREYASATVIPASEVVVDISNSAKDFIEKEVSAFFQSPDNSLYMLPATPQGLLESMGANGSTGPEAVAYAEKNAALLTARAGARDPSAIPSICRISAALQYPAGLEGSDASLASVLESLEFCLRVRGSEACVLEDLAKAIDLVHIRQDLVESGHSLLDHAFRAQQKYERTTNYCLDLASEQENTISDQWLPELRTAVQNAQASSEHCKYVRGLLDEWWEQPASTVVDWVTVDGQSVAAWQNHVKQLLAFYDKESLRT

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	AUGMIN subunit 6
Molecular weight formula_weight	36708.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MTMDREKERELELESAMYTNCLLLGLDPNVIGLGASNGTPRVGLFRHSNPKLGEQLLYFILSSLRGPAQSSKDFDKVWPIFDSAQSRDFRKVVQAIISELESQGALPRSNSRVSSLATCCGPRFVELLWQLSLHALREVHRRTFPADVASNPLPSSLTDVSFSHAATLLPVTKARIVLERRRFLKNAETAVQRQAMWSNLAHEMTAEFRGLCAEEAYLQQELEKLNDLRNKVKQEGEVWDDLVSSSSQNSHLVSKATRLWDSIMARKGQHEVLASGPIEDLIAHREHRYRISGSALLAAMDQSSQVPRAELLSAHSDDSASLADDKEL

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	AUGMIN subunit 7
Molecular weight formula_weight	37047.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAAKQMEEIQKKLRLLSYPRANAPAQSLLFAGMERYALLEWLFFKLLGDKSPFSQQNLQGDAGVRDEETVRIQYLAEIAKFLGITPTVDIEAIQGHGTYEDRMEMLRNIVDLVEASLFSDNQEWSIDEQVAKDIQLIDAIAERQSLIFSEECKLFPADVQIQSIYPLPDVSELETKLSEQAKILSNLQQKVDDLAAKHAYNPDEEYTEVESQLRARLESFLETARAFNTIYTKEIRPWTHMMEVPQLHGFGPAANRLLEAYNMLLKFLGNLKNLRDSHAALSIGSSGTVAGEPSSVTRIVSDCEAALTVLNRDLGILSASIAREQGERL

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	AUGMIN subunit 8
Molecular weight formula_weight	18658.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

EDVHQLRLLHNRYLQWRFAIARAESVMYIQRLTSEETLFNVWHAISELQDHVTRQRIGLQQLKLEIKLNSLLNDQMVSLEDWATLERDHVSSLVGAISDLEANTLRLPATGGTKADTESLKAAMSSALDVMQAMGSSIWSLLSKVEEMNIMVTELAVVVTKESSM

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli

Entity 7 Entity 7 polymer

Description description	Protein NEDD1
Molecular weight formula_weight	33256.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

WRLLAASGGDTVKLFDVSADSGDPCVLSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSLGTVPVTGKDGGDSAEECLSAISFSKKGSRYICSGGTGQIVKIWDLQRKLCIKKLKGHTSTITGVMYNCKDEHLASVSVGGDLIVHNLASGARATELKDPNGQVLRLLDYSRSSRHLLVTAGDDGTVHLWDTTGRSPKMSWLKQHSAPTAGVCFSPSNEKIIASVGMDKKLYTYDSGSRRSSSCIAYEAPFSSLAFGDNGYILVAGTSNGRVVFYDIRGKPQPVTVLHAFSNSEDVTSLSWQT

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Trichoplusia ni

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	8.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	49000

Augmin V junction with NEDD1 (WD)

1. Protein Identity and Related Structures Protein Identity & Related Structures

AUGMIN subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

AUGMIN subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

AUGMIN subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

AUGMIN subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

AUGMIN subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

AUGMIN subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein NEDD1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9pzm__assembly_1__model_1

9pzm__assembly_1__model_1 | I(q)

9pzm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source