← Back to search

9q8o

Crystal structure of Hsp82-MD in complex with the CS domain of Sgt1

Method: X-RAY DIFFRACTION D_max: 78.9 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9q8o
deposition_date	2025-02-25
last_revision	2026-01-21
title	Crystal structure of Hsp82-MD in complex with the CS domain of Sgt1
keywords	Complex, chaperone, co-chaperone; CHAPERONE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	25.06 Å
rg_electron	24.12 Å
i0	24961700.00
molecular_weight	39810.0 kDa
excluded_volume	50517 Å³
envelope_volume	63534 Å³
shell_volume	22664 Å³
envelope_diameter	80.6 Å
shell_rg	30.24 Å
envelope_rg	24.00 Å
shape_rg	24.11 Å
total_rg	24.97 Å
total_atoms	2819
n_residues	348
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	78.9 Å
rg_real	25.03 Å
rg_real_error	0.46 Å
i0_real	2.4960e+07
i0_real_error	3.2150e+05
rg_reciprocal	25.04 Å
i0_reciprocal	24960000.0000
total_estimate	0.9084
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	2
r_peak_primary	26.3 Å
skewness	0.239
kurtosis	-0.603
angular_range	— – 0.3150 Å⁻¹
current_alpha	0.0000
highest_alpha	4526000.0000
n_real_points	64
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.951; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.974; Smooth: 0.977

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	ATP-dependent molecular chaperone HSP82
formula_weight	30203.4 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2975

TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKDFE

Source

organism	Saccharomyces cerevisiae
common_name	;brewer's yeast ;
ncbi_taxonomy_id	4932
host_organism	Escherichia coli

Entity 2 polymer

description	Protein SGT1
formula_weight	10882.4 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

KFKIDWYQSSTSVTISLFTVNLPESKEQVNIYISPNDRRTLSISYQVPKSGSEFQYNAKLSHEVDPKAVSLKIFPKKLEITLSKIDSTQWKKLE

Source

organism	Saccharomyces cerevisiae
common_name	;brewer's yeast ;
ncbi_taxonomy_id	4932
host_organism	Escherichia coli

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	156

▶

6. Citations (1)

▶

length_a	69.505 Å
length_b	117.308 Å
length_c	148.641 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	I 2 2 2
int_tables_number	23
crystal_system	—

resolution	2.100 Å
resolution_low	92.080 Å
r_factor	—
r_work	0.1994
r_free	0.2457

fit	/app/data/saxs_computation/q8/9q8o/9q8o.fit
pddf	/app/data/pr_computation/q8/9q8o/9q8o.pr.out
profile	/app/data/saxs_computation/q8/9q8o/9q8o.dat

Crystal structure of Hsp82-MD in complex with the CS domain of Sgt1

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)