1usv

The Structure of the complex between Aha1 and HSP90

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HEAT SHOCK PROTEIN HSP82

SACCHAROMYCES CEREVISIAE

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	AHA1 × 1 （Q12449） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	AHA1 × 1 （Q12449） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	AHA1 × 1 （Q12449） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	AHA1 × 1 （Q12449） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HS82_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–260； UniProt 272–530 Author chain C； PDBConstruct 2–260； UniProt 272–530 Author chain E； PDBConstruct 2–260； UniProt 272–530 Author chain G； PDBConstruct 2–260； UniProt 272–530

AHA1

SACCHAROMYCES CEREVISIAE

UniProt Q12449

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	HEAT SHOCK PROTEIN HSP82 × 1 （P02829） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	HEAT SHOCK PROTEIN HSP82 × 1 （P02829） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	HEAT SHOCK PROTEIN HSP82 × 1 （P02829） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	HEAT SHOCK PROTEIN HSP82 × 1 （P02829） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q12449
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 15–170； UniProt 1–156 Author chain D； PDBConstruct 15–170； UniProt 1–156 Author chain F； PDBConstruct 15–170； UniProt 1–156 Author chain H； PDBConstruct 15–170； UniProt 1–156

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1usv
Deposition date deposition_date	2003-12-01
Structure title title	The Structure of the complex between Aha1 and HSP90
Keywords keywords	CHAPERONE-COMPLEX, CHAPERONE, ACTIVATOR, HSP90; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1usv__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1usv__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1usv__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.88 Å
Rg (electron density)	23.78 Å
Total Rg	24.69 Å
Atom count	3204
Residues	394
Excluded volume	57538 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1usv__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1usv__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1usv__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1usv__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	HEAT SHOCK PROTEIN HSP82
Molecular weight formula_weight	30502.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G
Atom count atom_count	12783

GKTKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKDFEL

Source Source

Source organism organism	SACCHAROMYCES CEREVISIAE
Common name common_name	;BAKER'S YEAST ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	AHA1
Molecular weight formula_weight	19118.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H

MRGSHHHHHHGMASMVVNNPNNWHWVDKNCIGWAKEYFKQKLVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRKGKVISLFDLKITVLIEGHVDSKDGSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGNDIQV

Source Source

Source organism organism	SACCHAROMYCES CEREVISIAE
Common name common_name	;BAKER'S YEAST ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	58

▼

6. Fold Classification (SCOP + CATH) 20 domains

SCOP 2.08 (8 domains)

Domain ID domain_id	d1usva_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.14 — Ribosomal protein S5 domain 2-like
Superfamily Superfamily superfamily	d.14.1 — Ribosomal protein S5 domain 2-like
Family Family family	d.14.1.8 — Hsp90 middle domain

Domain ID domain_id	d1usvb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.83 — Aha1/BPI domain-like
Superfamily Superfamily superfamily	d.83.2 — Activator of Hsp90 ATPase, Aha1
Family Family family	d.83.2.1 — Activator of Hsp90 ATPase, Aha1

Domain ID domain_id	d1usvc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.14 — Ribosomal protein S5 domain 2-like
Superfamily Superfamily superfamily	d.14.1 — Ribosomal protein S5 domain 2-like
Family Family family	d.14.1.8 — Hsp90 middle domain

Domain ID domain_id	d1usvd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.83 — Aha1/BPI domain-like
Superfamily Superfamily superfamily	d.83.2 — Activator of Hsp90 ATPase, Aha1
Family Family family	d.83.2.1 — Activator of Hsp90 ATPase, Aha1

Domain ID domain_id	d1usve_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.14 — Ribosomal protein S5 domain 2-like
Superfamily Superfamily superfamily	d.14.1 — Ribosomal protein S5 domain 2-like
Family Family family	d.14.1.8 — Hsp90 middle domain

Domain ID domain_id	d1usvf_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.83 — Aha1/BPI domain-like
Superfamily Superfamily superfamily	d.83.2 — Activator of Hsp90 ATPase, Aha1
Family Family family	d.83.2.1 — Activator of Hsp90 ATPase, Aha1

Domain ID domain_id	d1usvg_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.14 — Ribosomal protein S5 domain 2-like
Superfamily Superfamily superfamily	d.14.1 — Ribosomal protein S5 domain 2-like
Family Family family	d.14.1.8 — Hsp90 middle domain

Domain ID domain_id	d1usvh_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.83 — Aha1/BPI domain-like
Superfamily Superfamily superfamily	d.83.2 — Activator of Hsp90 ATPase, Aha1
Family Family family	d.83.2.1 — Activator of Hsp90 ATPase, Aha1

CATH v4.4 (12 domains)

Domain ID domain_id	1usvA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	230 — Ribosomal Protein S5; domain 2
Homologous superfamily homologous superfamily	80 —

Domain ID domain_id	1usvA02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11260 —

Domain ID domain_id	1usvB00
Class class	3 — Alpha Beta
Architecture architecture	15 — Super Roll
Topology topology	10 — Bactericidal permeability-increasing protein; domain 1
Homologous superfamily homologous superfamily	20 — Activator of Hsp90 ATPase Aha1, N-terminal domain

Domain ID domain_id	1usvC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	230 — Ribosomal Protein S5; domain 2
Homologous superfamily homologous superfamily	80 —

Domain ID domain_id	1usvC02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11260 —

Domain ID domain_id	1usvD00
Class class	3 — Alpha Beta
Architecture architecture	15 — Super Roll
Topology topology	10 — Bactericidal permeability-increasing protein; domain 1
Homologous superfamily homologous superfamily	20 — Activator of Hsp90 ATPase Aha1, N-terminal domain

Domain ID domain_id	1usvE01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	230 — Ribosomal Protein S5; domain 2
Homologous superfamily homologous superfamily	80 —

Domain ID domain_id	1usvE02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11260 —

Domain ID domain_id	1usvF00
Class class	3 — Alpha Beta
Architecture architecture	15 — Super Roll
Topology topology	10 — Bactericidal permeability-increasing protein; domain 1
Homologous superfamily homologous superfamily	20 — Activator of Hsp90 ATPase Aha1, N-terminal domain

Domain ID domain_id	1usvG01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	230 — Ribosomal Protein S5; domain 2
Homologous superfamily homologous superfamily	80 —

Domain ID domain_id	1usvG02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11260 —

Domain ID domain_id	1usvH00
Class class	3 — Alpha Beta
Architecture architecture	15 — Super Roll
Topology topology	10 — Bactericidal permeability-increasing protein; domain 1
Homologous superfamily homologous superfamily	20 — Activator of Hsp90 ATPase Aha1, N-terminal domain

▶

Unit-cell length a length_a	58.397 Å
Unit-cell length b length_b	207.930 Å
Unit-cell length c length_c	84.447 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	97.68 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	34.260 Å
R factor r_factor	0.2290
R_work r_work	0.2290
R_free r_free	0.2980

The Structure of the complex between Aha1 and HSP90

1. Protein Identity and Related Structures Protein Identity & Related Structures

HEAT SHOCK PROTEIN HSP82

State in the Current Structure

Other States of the Same Protein in the Database

AHA1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1usv__assembly_1__model_1

1usv__assembly_1__model_1 | I(q)

1usv__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 20 domains

SCOP 2.08 (8 domains)

CATH v4.4 (12 domains)

7. Citations (1)

The Structure of the complex between Aha1 and HSP90

1. Protein Identity and Related Structures Protein Identity & Related Structures

HEAT SHOCK PROTEIN HSP82

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

AHA1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1usv__assembly_1__model_1

1usv__assembly_1__model_1 | I(q)

1usv__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 20 domains

SCOP 2.08 (8 domains)

CATH v4.4 (12 domains)

7. Citations (1)