← Back to search

9qeu

Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 1

Method: X-RAY DIFFRACTION D_max: 58.1 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9qeu
deposition_date	2025-03-11
last_revision	2025-08-27
title	Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 1
keywords	E3 ligase, LIGASE; LIGASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	15.80 Å
rg_electron	15.02 Å
i0	8153810.00
molecular_weight	13879.0 kDa
excluded_volume	13290 Å³
envelope_volume	20794 Å³
shell_volume	12116 Å³
envelope_diameter	60.0 Å
shell_rg	20.31 Å
envelope_rg	15.44 Å
shape_rg	15.03 Å
total_rg	15.78 Å
total_atoms	1046
n_residues	128
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	58.1 Å
rg_real	15.78 Å
rg_real_error	0.50 Å
i0_real	8.1540e+06
i0_real_error	1.0370e+05
rg_reciprocal	15.78 Å
i0_reciprocal	8154000.0000
total_estimate	0.7557
solution_quality	GOOD a GOOD solution
n_peaks	3
r_peak_primary	19.9 Å
skewness	0.354
kurtosis	-0.097
angular_range	— – 0.5000 Å⁻¹
current_alpha	0.0000
highest_alpha	2578000.0000
n_real_points	80
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.657; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.848; Smooth: 0.000

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	E3 ubiquitin-protein ligase CHIP
formula_weight	14649.7 kDa
ec_number	2.3.2.27
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	1159

SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSI

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli

Entity 2 non-polymer

description	;~{N}-[(1~{R},2~{R})-2-[[(1~{S})-1-(2-methoxyphenyl)-3-(methylamino)-3-oxidanylidene-propyl]carbamoyl]cyclopentyl]-4,5,6,7-tetrahydro-1~{H}-indazole-3-carboxamide ;
formula_weight	467.6 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	SULFATE ION
formula_weight	96.1 kDa
src_method	syn
entity_count	2

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	113

▶

6. Citations (1)

▶

length_a	47.051 Å
length_b	74.569 Å
length_c	78.114 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	C 2 2 21
int_tables_number	20
crystal_system	—

resolution	1.353 Å
resolution_low	39.790 Å
r_factor	0.2152
r_work	0.2141
r_free	0.2356

fit	/app/data/saxs_computation/qe/9qeu/9qeu.fit
pddf	/app/data/pr_computation/qe/9qeu/9qeu.pr.out
profile	/app/data/saxs_computation/qe/9qeu/9qeu.dat

Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 1

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction