← Back to search

9qgj

Human PPAR-gamma ligand binding domain in complex with LW90

Method: X-RAY DIFFRACTION D_max: 85.9 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9qgj
deposition_date	2025-03-13
last_revision	2026-03-25
title	Human PPAR-gamma ligand binding domain in complex with LW90
keywords	;PPAR, PPAR gamma, PPARg, peroxisome proliferator-activated receptor gamma, nuclear receptor, transcription factor, partial agonist, agonist, TRANSCRIPTION ;; TRANSCRIPTION
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	26.01 Å
rg_electron	25.24 Å
i0	101426000.00
molecular_weight	54108.0 kDa
excluded_volume	52956 Å³
envelope_volume	89411 Å³
shell_volume	29381 Å³
envelope_diameter	89.2 Å
shell_rg	32.35 Å
envelope_rg	25.33 Å
shape_rg	25.19 Å
total_rg	25.90 Å
total_atoms	4098
n_residues	518
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	85.9 Å
rg_real	25.95 Å
rg_real_error	0.65 Å
i0_real	1.0140e+08
i0_real_error	1.4140e+06
rg_reciprocal	25.97 Å
i0_reciprocal	101400000.0000
total_estimate	0.8882
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	29.6 Å
skewness	0.282
kurtosis	-0.376
angular_range	— – 0.3050 Å⁻¹
current_alpha	0.0000
highest_alpha	21270000.0000
n_real_points	62
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.872; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.996; Smooth: 0.930

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Peroxisome proliferator-activated receptor gamma
formula_weight	31410.5 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	B,A
atom_count	4120

GSHMESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	;4-[5-chloranyl-1-[2-chloranyl-6-(trifluoromethyl)phenyl]carbonyl-indazol-3-yl]-3-[[(3~{S})-1-[(2-methylpropan-2-yl)oxycarbonyl]piperidin-3-yl]methoxy]benzoic acid ;
formula_weight	692.5 kDa
src_method	syn
entity_count	2

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	22

▶

6. Citations (1)

▶

length_a	94.166 Å
length_b	61.582 Å
length_c	119.003 Å
angle_alpha	90.00 °
angle_beta	101.82 °
angle_gamma	90.00 °
z_pdb	8

space_group	C 1 2 1
int_tables_number	5
crystal_system	monoclinic

resolution	2.200 Å
resolution_low	58.240 Å
r_factor	0.2245
r_work	0.2229
r_free	0.2554

fit	/app/data/saxs_computation/qg/9qgj/9qgj.fit
pddf	/app/data/pr_computation/qg/9qgj/9qgj.pr.out
profile	/app/data/saxs_computation/qg/9qgj/9qgj.dat

Human PPAR-gamma ligand binding domain in complex with LW90

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction