SAXSdb — 9qqs

▼

1. Structure Basics

entry_id	9qqs
deposition_date	2025-04-02
title	Structure of the MEGF8-MOSMO complex with nanobody 270 (Focused refinement)
keywords	;E3 Ubiquitin Ligase, Hedgehog Signaling, Single-pass Membrane Protein, Membrane Protein Complex, Smoothened, Tetraspanin, Cell Surface Receptor, Primary Cilium, Morphogen, Signal Transduction, Human, Carpenter Syndrome, Cancer, Nanobody, Palmitoylation, GDN, MEMBRANE PROTEIN ;; MEMBRANE PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	32.00 Å
rg_electron	32.42 Å
i0	88817200.00
molecular_weight	51193.0 kDa
excluded_volume	50122 Å³
envelope_volume	90775 Å³
shell_volume	25818 Å³
envelope_diameter	117.9 Å
shell_rg	34.98 Å
envelope_rg	33.12 Å
shape_rg	32.39 Å
total_rg	32.63 Å
total_atoms	3891
n_residues	491
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	114.1 Å
rg_real	32.55 Å
rg_real_error	1.18 Å
i0_real	8.8820e+07
i0_real_error	1.5100e+06
rg_reciprocal	32.32 Å
i0_reciprocal	88800000.0000
total_estimate	0.7671
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	25.6 Å
skewness	0.604
kurtosis	-0.348
angular_range	— – 0.2450 Å⁻¹
current_alpha	0.0000
highest_alpha	7089000.0000
n_real_points	50
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.582; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.396; Smooth: 0.826

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (6)

Entity 1 polymer

description	Modulator of smoothened protein
formula_weight	22594.2 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	3923

MDKLTIISGCLFLAADIFAIASIANPDWINTGESAGALTVGLVRQCQTIHGRDRTCIPPRLPPEWVTTLFFIIMGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIGFYINEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPGGTLEVLFQGPGGSGSAWSHPQFEKGGGSGGGSGGSAWSHPQFEK

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Homo sapiens

Entity 2 polymer

description	Isoform 2 of Multiple epidermal growth factor-like domains protein 8
formula_weight	50353.0 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

KCQCNGHADTCNEQDGTGCPCQNNTETGTCQGSSPSDRRDCYKYQCAKCRESFHGSPLGGQQCYRLISVEQECCLDPTSQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVAPDTGVHTVHIQPPPAPPPPPPPADGGPRGAGDPGGAGASSGPGAPAEPRVREVWPRGLITYVTVTEPSAVLVVRGVRDRLVITYPHEHHALKSSRFYLLLLGVGDPSGPGANGSADSQGLLFFRQDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRHLQEMTKMASRPFAKVTVCFPPDPTAPASAWKPAGLPPPAFRRSEPFLAPLLLTGAGGPWGPMGGGCCPPAIPATTAGLRAGPITLEPTEDGMAGVATLLLQLPGGPHAPNGACLGSALVTLRHRLHEYCGGGGGAGGSGHGTGAGRKGLLSQDNLTSMSLGTETSQVAPA

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Homo sapiens

Entity 3 polymer

description	Nanobody 270
formula_weight	14378.9 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	C

QVQLVESGGGLVQAGGSLRLSCAASGSIFSYDDMGWYRQAPGKQRELVATFTNVGSTNYVDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCHAYTVRRFQGMEYWGKGTQVTVSSHHHHHHEPEA

Source

organism	Lama glama
ncbi_taxonomy_id	9844
host_organism	Escherichia coli K-12

Entity 4 non-polymer

description	PALMITIC ACID
formula_weight	256.4 kDa
src_method	syn
entity_count	1

Entity 5 non-polymer

description	;(1~{S},2~{S},4~{S},5'~{R},6~{R},7~{S},8~{R},9~{S},12~{S},13~{R},16~{S})-16-methoxy-5',7,9,13-tetramethyl-spiro[5-oxapentacyclo[10.8.0.0^{2,9}.0^{4,8}.0^{13,18}]icos-18-ene-6,2'-oxane] ;
formula_weight	428.6 kDa
src_method	syn
entity_count	1

Entity 6 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	32

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	triclinic

resolution	2.65 Å
resolution_method	—
num_particles	142461

fit	/app/data/saxs_computation/qq/9qqs/9qqs.fit
pddf	/app/data/pr_computation/qq/9qqs/9qqs.pr.out
profile	/app/data/saxs_computation/qq/9qqs/9qqs.dat

Structure of the MEGF8-MOSMO complex with nanobody 270 (Focused refinement)

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

EM 3D

5. Entities & Polymer Info (6)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 polymer

Polymer

Source

Entity 4 non-polymer

Entity 5 non-polymer

Entity 6 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)