9rku

Agrobacterium phage 7-7-1 baseplate

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	Putative tail biosynthetic protein × 3 （J7F9D2） Structural protein × 6 （J7FAD9） Baseplate protein × 12 （J7F8X4） Putative tail biosynthetic protein × 6 （J7FAD8） Putative structural protein × 6 （J7FA56） Tail sheath protein × 12 （J7FA80） Structural protein × 12 （J7F8Z8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	J7FAQ1_9CAUD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Ac； PDBConstruct 1–189； UniProt 1–189 Author chain Ad； PDBConstruct 1–189； UniProt 1–189 Author chain Ae； PDBConstruct 1–189； UniProt 1–189

Putative tail biosynthetic protein

OrganismNot specified

UniProt J7F9D2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	Baseplate protein × 3 （J7FAQ1） Structural protein × 6 （J7FAD9） Baseplate protein × 12 （J7F8X4） Putative tail biosynthetic protein × 6 （J7FAD8） Putative structural protein × 6 （J7FA56） Tail sheath protein × 12 （J7FA80） Structural protein × 12 （J7F8Z8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	J7F9D2_9CAUD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain Af； PDBConstruct 1–454； UniProt 1–454 Author chain Ag； PDBConstruct 1–454； UniProt 1–454 Author chain Ah； PDBConstruct 1–454； UniProt 1–454

Structural protein

OrganismNot specified

UniProt J7FAD9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	Baseplate protein × 3 （J7FAQ1） Putative tail biosynthetic protein × 3 （J7F9D2） Baseplate protein × 12 （J7F8X4） Putative tail biosynthetic protein × 6 （J7FAD8） Putative structural protein × 6 （J7FA56） Tail sheath protein × 12 （J7FA80） Structural protein × 12 （J7F8Z8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	J7FAD9_9CAUD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain Ai； PDBConstruct 1–286； UniProt 1–286 Author chain Aj； PDBConstruct 1–286； UniProt 1–286 Author chain Ak； PDBConstruct 1–286； UniProt 1–286 Author chain Al； PDBConstruct 1–286； UniProt 1–286 Author chain Am； PDBConstruct 1–286； UniProt 1–286 Author chain An； PDBConstruct 1–286； UniProt 1–286

Baseplate protein

OrganismNot specified

UniProt J7F8X4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	Baseplate protein × 3 （J7FAQ1） Putative tail biosynthetic protein × 3 （J7F9D2） Structural protein × 6 （J7FAD9） Putative tail biosynthetic protein × 6 （J7FAD8） Putative structural protein × 6 （J7FA56） Tail sheath protein × 12 （J7FA80） Structural protein × 12 （J7F8Z8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	J7F8X4_9CAUD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Ao； PDBConstruct 1–396； UniProt 1–396 Author chain Ap； PDBConstruct 1–396； UniProt 1–396 Author chain Aq； PDBConstruct 1–396； UniProt 1–396 Author chain Ar； PDBConstruct 1–396； UniProt 1–396 Author chain As； PDBConstruct 1–396； UniProt 1–396 Author chain At； PDBConstruct 1–396； UniProt 1–396 Author chain Au； PDBConstruct 1–396； UniProt 1–396 Author chain Av； PDBConstruct 1–396； UniProt 1–396 Author chain Aw； PDBConstruct 1–396； UniProt 1–396 Author chain Ax； PDBConstruct 1–396； UniProt 1–396 Author chain Ay； PDBConstruct 1–396； UniProt 1–396 Author chain Az； PDBConstruct 1–396； UniProt 1–396

Putative tail biosynthetic protein

OrganismNot specified

UniProt J7FAD8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	Baseplate protein × 3 （J7FAQ1） Putative tail biosynthetic protein × 3 （J7F9D2） Structural protein × 6 （J7FAD9） Baseplate protein × 12 （J7F8X4） Putative structural protein × 6 （J7FA56） Tail sheath protein × 12 （J7FA80） Structural protein × 12 （J7F8Z8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	J7FAD8_9CAUD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A1； PDBConstruct 1–398； UniProt 1–398 Author chain A2； PDBConstruct 1–398； UniProt 1–398 Author chain A3； PDBConstruct 1–398； UniProt 1–398 Author chain A4； PDBConstruct 1–398； UniProt 1–398 Author chain A5； PDBConstruct 1–398； UniProt 1–398 Author chain A6； PDBConstruct 1–398； UniProt 1–398

Putative structural protein

OrganismNot specified

UniProt J7FA56

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	Baseplate protein × 3 （J7FAQ1） Putative tail biosynthetic protein × 3 （J7F9D2） Structural protein × 6 （J7FAD9） Baseplate protein × 12 （J7F8X4） Putative tail biosynthetic protein × 6 （J7FAD8） Tail sheath protein × 12 （J7FA80） Structural protein × 12 （J7F8Z8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	J7FA56_9CAUD
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain A0； PDBConstruct 1–178； UniProt 1–178 Author chain A7； PDBConstruct 1–178； UniProt 1–178 Author chain A8； PDBConstruct 1–178； UniProt 1–178 Author chain A9； PDBConstruct 1–178； UniProt 1–178 Author chain BA； PDBConstruct 1–178； UniProt 1–178 Author chain BB； PDBConstruct 1–178； UniProt 1–178

Tail sheath protein

OrganismNot specified

UniProt J7FA80

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	Baseplate protein × 3 （J7FAQ1） Putative tail biosynthetic protein × 3 （J7F9D2） Structural protein × 6 （J7FAD9） Baseplate protein × 12 （J7F8X4） Putative tail biosynthetic protein × 6 （J7FAD8） Putative structural protein × 6 （J7FA56） Structural protein × 12 （J7F8Z8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	J7FA80_9CAUD
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain BC； PDBConstruct 1–503； UniProt 1–503 Author chain BD； PDBConstruct 1–503； UniProt 1–503 Author chain BE； PDBConstruct 1–503； UniProt 1–503 Author chain BF； PDBConstruct 1–503； UniProt 1–503 Author chain BG； PDBConstruct 1–503； UniProt 1–503 Author chain BH； PDBConstruct 1–503； UniProt 1–503 Author chain BI； PDBConstruct 1–503； UniProt 1–503 Author chain BJ； PDBConstruct 1–503； UniProt 1–503 Author chain BK； PDBConstruct 1–503； UniProt 1–503 Author chain BL； PDBConstruct 1–503； UniProt 1–503 Author chain BM； PDBConstruct 1–503； UniProt 1–503 Author chain BN； PDBConstruct 1–503； UniProt 1–503

Structural protein

OrganismNot specified

UniProt J7F8Z8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	Baseplate protein × 3 （J7FAQ1） Putative tail biosynthetic protein × 3 （J7F9D2） Structural protein × 6 （J7FAD9） Baseplate protein × 12 （J7F8X4） Putative tail biosynthetic protein × 6 （J7FAD8） Putative structural protein × 6 （J7FA56） Tail sheath protein × 12 （J7FA80）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	J7F8Z8_9CAUD
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain BO； PDBConstruct 1–136； UniProt 1–136 Author chain BP； PDBConstruct 1–136； UniProt 1–136 Author chain BQ； PDBConstruct 1–136； UniProt 1–136 Author chain BR； PDBConstruct 1–136； UniProt 1–136 Author chain BS； PDBConstruct 1–136； UniProt 1–136 Author chain BT； PDBConstruct 1–136； UniProt 1–136 Author chain BU； PDBConstruct 1–136； UniProt 1–136 Author chain BV； PDBConstruct 1–136； UniProt 1–136 Author chain BW； PDBConstruct 1–136； UniProt 1–136 Author chain BX； PDBConstruct 1–136； UniProt 1–136 Author chain BY； PDBConstruct 1–136； UniProt 1–136 Author chain BZ； PDBConstruct 1–136； UniProt 1–136

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9rku
Deposition date deposition_date	2025-06-14
Structure title title	Agrobacterium phage 7-7-1 baseplate
Keywords keywords	Flagella phage, Agrobacterium sp. H13-3, Baseplate, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9rku__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9rku__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9rku__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	85.22 Å
Rg (electron density)	84.29 Å
Total Rg	84.47 Å
Atom count	284548
Residues	18903
Excluded volume	2551400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9rku__assembly_1__model_1`	60-meric （60）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Baseplate protein
Molecular weight formula_weight	20893.7 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ac,Ad,Ae
Atom count atom_count	284548

MTTTKTFDERNRDTQDGFERHVFRKLDHTDTGAIVTVEGSGTMDEDVPVINSGYGFNPEDDEELEVFLLSDGSDASGKFGVMTIPRNKQRKWPKKTGGIQHPFNADKFVQLDDDSIWLKDGKFTLGDNRSLSITVEGNNVVIDTGGGELDIRSSKLMHNGVNIGDSHVHPQQADSDGDTEADTDPPKRD

Entity 2 Entity 2 polymer

Description description	Putative tail biosynthetic protein
Molecular weight formula_weight	49304.4 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Af,Ag,Ah

MIKPMRIFIGGEELETYTSARLQRTKKQLTGSLTVEIFLNYVPSKPVIVNAVRGKEILVYVMGELAFTGIIDKRKGKTVAGSQPRDASGRFAYSGGPGSMSDEGGSDVTVNFAKGQGYSVTLTARGRTKYLVDSSHSHPTGSFKDTSDRKVIEALVKEHKVVLDWQGTEVKEPKITLRDGNRIFNEIFERCNQNCHFAYETRDGKLLVTDGTTGVVGEDIVLGQNILDFSAEQSEDRANSEITVKGHRVAKDVWGKNAIVQPVQSVADSWVGANIPLTIQHYGDATNESLQRRAKFEADRRAAESKSVNVTVFHVAQQGGIPWDIGNIHYVEIPPEGIFDVMECVSLTYSVDAKSTLETQLELAPPPSESISGASSGLLSSISNSLADISTKGVARRVQAGIKLIAGQYPSTWTSAALSAITTPVNVIASVVNSLLLNEDESTPKQPPLRLPPE

Entity 3 Entity 3 polymer

Description description	Structural protein
Molecular weight formula_weight	31474.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ai,Aj,Ak,Al,Am,An

MNVLVPGIDGMVSAGKFEYSGCCPPDFADMDECTLATSYVGLLPSGPLWDRAKYEAITTITATGNCAACWTEDHCPTLVDYAVNVGARLASVIDMTLWPAVRESDPFTAVTSTADWLERFKWVNCFETSCRSKALGEITPIEYMTECGPVYVAINYPPSIKQAFESALIKSLERLSMGIIKNLASINFVIEPLKVRVVPLDTTNACENETLCVTFEKTSDFFDGVNQNPCGIPSPVAAYIDRDVMQLPSELPKYIWPGHMAAECVVRSLLSHVSRFCVVRTDQTPD

Entity 4 Entity 4 polymer

Description description	Baseplate protein
Molecular weight formula_weight	43428.8 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ao,Ap,Aq,Ar,As,At,Au,Av,Aw,Ax,Ay,Az

MACTIQRPEPQALRDKIATRFSTNVLGGAEIIPESNEFYVVTLEYAMQEEFFAFAEQMWREQDPRYACCENLVKMAARRGVYPKPAQFAQGYVRMTGVPGSALNQNLRFQFENQTYEAASVVPDQLPATGVLVLRVSAVTPGPSGNIRVTEGSLVTPVPGISSAVTAYGGNFCGGDDAEECEPFRTRYLQRLQYEPRLTVEWLKSKAMEWPCVTDVFDLGPNCCSVNALGEVECPNNIEFYVLFRDTFDCGLAPQCVVDEITDWLFGSPQGLGQGEAEFGICGKVRTATAVNLDIYLNGLSCATPAQARVVEQRITDFINRHPPSTNLTVEQLRFIGLQVLGSSFAFDVAIRSPGDASQSGLRFNACGDAEIDCDYKACLNSVQVINNNVTTSGCL

Entity 5 Entity 5 polymer

Description description	Putative tail biosynthetic protein
Molecular weight formula_weight	43729.6 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1,A2,A3,A4,A5,A6

MAGPCYNPNEHYLPASFKGVPFDADSSDSEHGRNGAEAEFVFGERTGYADLGIKIRSYSIRARFQTNDHVALSNAFIAVLESTGPGLLVHPTRGPVMAACRSARVTDSKVDAAGVTYIDIDFVEANDTVTGFGLVGSLIALALSPIITATEESFKRYYSPENVRYYNSETVIATMAEAVQQVQTGYLALSGNDTSQEKWTIVRDFRNVLIDEFTFFDPANSWNVLRNGFSYLDSAAVGQDKFTILRNIINWSSSHSELDGESADAQNAIFSAVRVLATAYLSKAYMETVASTVNEGLAQYDQIAAILEQEAQIAQEDCHDNEFFLSIREFSVSVARVMVNRAYNSPALIVYSFPGTMHSLVVAWEIFGDAKRSRELEGRNTGAPWAIGPKVIAERVRA

Entity 6 Entity 6 polymer

Description description	Putative structural protein
Molecular weight formula_weight	19321.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A7,A8,A9,A0,BA,BB

MTCNFETADRRKRFWTTQVAACGQSSDDCGDCARPGLQLLCNGEGRITIATDNYVAGLALNILLTDASKADTGCGWTPGNRGGFWGDSFRSDNMRSGSKIRQVTARGSMRETVALIRAYAIDDLKKLVAYGVAKSVDVDLTYQGSNKIDMTIMIQGVDGNESRVGLTGERIANAWVWS

Entity 7 Entity 7 polymer

Description description	Tail sheath protein
Molecular weight formula_weight	54120.4 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BN,BC,BD,BE,BF,BG,BH,BI,BJ,BK,BL,BM

MAQDALSDGFVRLCIDPSLNFFGEGCKILVEGQITDDATAAENVVTCVNSELDLVERFGQGSVLTESLRKVFCMCKSGVSVYALPRADAAAAVSAVYTLTVTGTALTDGRVQLYMGEAEYSLDIGVDEGDTPTQIAAKIVAAISPDFPYEATAAAGVITLTARNGGTIGNHLSVIYTNLGSCTSVTPEGVTVAFAQTTPGSVNPEPNDYASVVNECCFAVYVLSSDDTDWQENLRDWIRSAWDCSKPQCFGHGYVFNKGTLGQVLADGDNSAELSRLALPTTYPVLPYLTNAAYGALSACSTCENPELNVQGQTYGLLSCINMPESCTPGWEFTEVTQLQNNGFVVSGPATTSGQGNFTSPYIYNDVTNYLRDEKNRPNATFRDASSRRLAAATGVALATFLQQFNGLAVFTKNTNIKTGIIGTNLRLMLGKIRKWASDNVGVLFSEFDNINEDIQLVSDFDVQPKCVGQPGVFHLNMRYRPPVRGARINVNLVPALFDNCDR

Entity 8 Entity 8 polymer

Description description	Structural protein
Molecular weight formula_weight	14503.3 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BO,BP,BQ,BR,BS,BT,BU,BV,BW,BX,BY,BZ

MACNKQNGVKNILITFTHCDTGEVIGPISHEQPDDTLPTYKTCAWTNTALTNGAVMRSASNATMTLPVVRDPRVPLAWYQGCAQIDAQVEKFDGTVMTLTEGAVTEPEESDGRAVTMTIIAAEIDELLPPGSLAAA

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.44 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	8161

Agrobacterium phage 7-7-1 baseplate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative tail biosynthetic protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Structural protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative tail biosynthetic protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative structural protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Structural protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9rku__assembly_1__model_1

9rku__assembly_1__model_1 | I(q)

9rku__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer