SAXSdb — 9ryc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Polymerase acidic protein

Influenza A virus (A/Brevig Mission/1/1918(H1N1))

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 1–716	Not recorded	RNA-directed RNA polymerase catalytic subunit × 1 （Q3HM40） Polymerase basic protein 2 × 1 （Q3HM41） Nuclear export protein × 1 （Q77IX1）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.93 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9RYC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NHA 1918 H1N1 Viral influenza polymerase heterotrimer - Endonuclease and priming loop ordered (Class2a) Deposited 2021-02-10	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot and 3 microlitres sample.	Resolution 2.91 Å
7NHC 1918 H1N1 Viral influenza polymerase heterotrimer - Endonuclease ordered (Class2b) Deposited 2021-02-10	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot and 3 microlitres sample.	Resolution 2.87 Å
7NHX 1918 H1N1 Viral influenza polymerase heterotrimer - full transcriptase (Class1) Deposited 2021-02-11	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot and 3 microlitres sample.	Resolution 3.23 Å
7NI0 1918 H1N1 Viral influenza polymerase heterotrimer - Replicase (class 3) Deposited 2021-02-11	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot and 3 microlitres sample.	Resolution 3.32 Å
7NIK 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8189 core Deposited 2021-02-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.20 Å
7NIL 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8190 core Deposited 2021-02-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.01 Å
7NIR 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8191 core Deposited 2021-02-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.70 Å
7NIS 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8192 core Deposited 2021-02-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.96 Å
7NJ3 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8196 core Deposited 2021-02-15	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.48 Å
7NJ4 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8198 core Deposited 2021-02-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.84 Å
7NJ5 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8199 core Deposited 2021-02-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
7NJ7 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8200 core Deposited 2021-02-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.82 Å
7NK1 1918 Influenza virus polymerase heterotirmer in complex with vRNA promoters and Nb8201 Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.22 Å
7NK2 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8202 core Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.84 Å
7NK4 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8203 core Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.32 Å
7NK6 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8204 Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.72 Å
7NK8 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8205 core Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.34 Å
7NKA 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8206 Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.07 Å
7NKC 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8207 Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.46 Å
7NKI 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8209 core Deposited 2021-02-18	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.67 Å
7NKR 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8210 Deposited 2021-02-18	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.60 Å
8R60 1918 H1N1 Viral polymerase heterotrimer in complex with 4 repeat serine-5 phosphorylated PolII peptide Deposited 2023-11-19	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å
8R65 1918 H1N1 Viral polymerase heterotrimer in complex with 4 repeat serine-5 phosphorylated PolII peptide with ordered PB2 C-terminal domains Deposited 2023-11-20	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.23 Å
9RVE Structure of human 1918 influenza A polymerase heterotrimer in complex with 1918 NEP. Deposited 2025-07-08	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–716（716 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.53 Å

24 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PA_I18A0
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–716； UniProt 1–716

RNA-directed RNA polymerase catalytic subunit

Influenza A virus (A/Brevig Mission/1/1918(H1N1))

UniProt Q3HM40

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain B； UniProt 1–757	Not recorded	Polymerase acidic protein × 1 （Q3HM39） Polymerase basic protein 2 × 1 （Q3HM41） Nuclear export protein × 1 （Q77IX1）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.93 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9RYC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NHA 1918 H1N1 Viral influenza polymerase heterotrimer - Endonuclease and priming loop ordered (Class2a) Deposited 2021-02-10	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: pentameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot and 3 microlitres sample.	Resolution 2.91 Å
7NHC 1918 H1N1 Viral influenza polymerase heterotrimer - Endonuclease ordered (Class2b) Deposited 2021-02-10	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: pentameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot and 3 microlitres sample.	Resolution 2.87 Å
7NHX 1918 H1N1 Viral influenza polymerase heterotrimer - full transcriptase (Class1) Deposited 2021-02-11	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: pentameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot and 3 microlitres sample.	Resolution 3.23 Å
7NI0 1918 H1N1 Viral influenza polymerase heterotrimer - Replicase (class 3) Deposited 2021-02-11	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: pentameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot and 3 microlitres sample.	Resolution 3.32 Å
7NIK 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8189 core Deposited 2021-02-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.20 Å
7NIL 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8190 core Deposited 2021-02-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.01 Å
7NIR 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8191 core Deposited 2021-02-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.70 Å
7NIS 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8192 core Deposited 2021-02-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.96 Å
7NJ3 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8196 core Deposited 2021-02-15	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.48 Å
7NJ4 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8198 core Deposited 2021-02-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.84 Å
7NJ5 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8199 core Deposited 2021-02-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
7NJ7 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8200 core Deposited 2021-02-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.82 Å
7NK1 1918 Influenza virus polymerase heterotirmer in complex with vRNA promoters and Nb8201 Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.22 Å
7NK2 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8202 core Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.84 Å
7NK4 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8203 core Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.32 Å
7NK6 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8204 Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.72 Å
7NK8 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8205 core Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.34 Å
7NKA 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8206 Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.07 Å
7NKC 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8207 Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.46 Å
7NKI 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8209 core Deposited 2021-02-18	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.67 Å
7NKR 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8210 Deposited 2021-02-18	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.60 Å
8R60 1918 H1N1 Viral polymerase heterotrimer in complex with 4 repeat serine-5 phosphorylated PolII peptide Deposited 2023-11-19	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å
8R65 1918 H1N1 Viral polymerase heterotrimer in complex with 4 repeat serine-5 phosphorylated PolII peptide with ordered PB2 C-terminal domains Deposited 2023-11-20	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.23 Å
9RVE Structure of human 1918 influenza A polymerase heterotrimer in complex with 1918 NEP. Deposited 2025-07-08	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–757（757 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.53 Å

24 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RDRP_I18A0
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–757； UniProt 1–757

Polymerase basic protein 2

Influenza A virus (A/Brevig Mission/1/1918(H1N1))

UniProt Q3HM41

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain C； UniProt 1–759	Not recorded	Polymerase acidic protein × 1 （Q3HM39） RNA-directed RNA polymerase catalytic subunit × 1 （Q3HM40） Nuclear export protein × 1 （Q77IX1）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.93 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9RYC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NHA 1918 H1N1 Viral influenza polymerase heterotrimer - Endonuclease and priming loop ordered (Class2a) Deposited 2021-02-10	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: pentameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot and 3 microlitres sample.	Resolution 2.91 Å
7NHC 1918 H1N1 Viral influenza polymerase heterotrimer - Endonuclease ordered (Class2b) Deposited 2021-02-10	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: pentameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot and 3 microlitres sample.	Resolution 2.87 Å
7NHX 1918 H1N1 Viral influenza polymerase heterotrimer - full transcriptase (Class1) Deposited 2021-02-11	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: pentameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot and 3 microlitres sample.	Resolution 3.23 Å
7NI0 1918 H1N1 Viral influenza polymerase heterotrimer - Replicase (class 3) Deposited 2021-02-11	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: pentameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot and 3 microlitres sample.	Resolution 3.32 Å
7NIK 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8189 core Deposited 2021-02-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.20 Å
7NIL 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8190 core Deposited 2021-02-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.01 Å
7NIR 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8191 core Deposited 2021-02-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.70 Å
7NIS 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8192 core Deposited 2021-02-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.96 Å
7NJ3 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8196 core Deposited 2021-02-15	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.48 Å
7NJ4 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8198 core Deposited 2021-02-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.84 Å
7NJ5 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8199 core Deposited 2021-02-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
7NJ7 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8200 core Deposited 2021-02-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.82 Å
7NK1 1918 Influenza virus polymerase heterotirmer in complex with vRNA promoters and Nb8201 Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.22 Å
7NK2 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8202 core Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.84 Å
7NK4 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8203 core Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.32 Å
7NK6 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8204 Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.72 Å
7NK8 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8205 core Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.34 Å
7NKA 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8206 Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.07 Å
7NKC 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8207 Deposited 2021-02-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.46 Å
7NKI 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8209 core Deposited 2021-02-18	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.67 Å
7NKR 1918 H1N1 Viral influenza polymerase heterotrimer with Nb8210 Deposited 2021-02-18	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.60 Å
8R60 1918 H1N1 Viral polymerase heterotrimer in complex with 4 repeat serine-5 phosphorylated PolII peptide Deposited 2023-11-19	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å
8R65 1918 H1N1 Viral polymerase heterotrimer in complex with 4 repeat serine-5 phosphorylated PolII peptide with ordered PB2 C-terminal domains Deposited 2023-11-20	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.23 Å
9RVE Structure of human 1918 influenza A polymerase heterotrimer in complex with 1918 NEP. Deposited 2025-07-08	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.53 Å

24 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PB2_I18A0
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–759； UniProt 1–759

Nuclear export protein

Influenza A virus (A/Brevig Mission/1/1918(H1N1))

UniProt Q77IX1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain D； UniProt 1–121	Not recorded	Polymerase acidic protein × 1 （Q3HM39） RNA-directed RNA polymerase catalytic subunit × 1 （Q3HM40） Polymerase basic protein 2 × 1 （Q3HM41）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.93 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9RYC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9RVE Structure of human 1918 influenza A polymerase heterotrimer in complex with 1918 NEP. Deposited 2025-07-08	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–121（121 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.53 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NEP_I18A0
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 10–130； UniProt 1–121

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ryc
Deposition date deposition_date	2025-07-15
Structure title title	Structure of human 1918 influenza A polymerase heterotrimer in complex with WSN NEP.
Keywords keywords	influenza virus, nuclear export, NEP, NS2, 1918 polymerase, spanish Flu, viral polymerase, cryo-EM, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	40.91 Å
Radius of gyration Rg (electron density) rg_electron	40.54 Å
Forward intensity I(0) i0	644425000.00
Molecular weight molecular_weight	206760.0 kDa
Excluded volume excluded_volume	258610 Å³
Envelope volume envelope_volume	346640 Å³
Hydration-shell volume shell_volume	70999 Å³
Envelope diameter envelope_diameter	160.0 Å
Shell Rg shell_rg	46.47 Å
Envelope Rg envelope_rg	40.13 Å
Shape Rg shape_rg	40.56 Å
Total Rg total_rg	40.79 Å
Total atoms total_atoms	28022
Residues n_residues	1797
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	151.2 Å
Rg (real space) rg_real	40.92 Å
Rg uncertainty (real space) rg_real_error	1.39 Å
I(0) (real space) i0_real	6.4440e+08
I(0) uncertainty (real space) i0_real_error	9.3690e+06
Rg (reciprocal space) rg_reciprocal	40.91 Å
I(0) (reciprocal space) i0_reciprocal	644400000.0000
Solution quality estimate total_estimate	0.8233
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	50.4 Å
Skewness Skewness skewness	0.466
Kurtosis Kurtosis kurtosis	0.231
Angular range angular_range	— – 0.1950 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	123400000.0000
Real-space data points n_real_points	40
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.590; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.965; Smooth: 0.965

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Polymerase acidic protein
Molecular weight formula_weight	82707.4 kDa
EC 编号 ec_number	3.1.-.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	28022

MEDFVRQCFNPMIVELAEKAMKEYGEDLKIETNKFAAICTHLEVCFMYSDFHFINERGESIIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNGYIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGEGIPLYDAIKCMRTFFGWKEPNVVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNMKKTSQLKWALGENMAPEKVDFDDCKDVSDLKQYDSDEPELRSLASWIQSEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLLRSAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAESSVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALR

来源 Source

来源生物 organism	Influenza A virus (A/Brevig Mission/1/1918(H1N1))
NCBI Class编号 ncbi_taxonomy_id	88776
宿主生物 host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	RNA-directed RNA polymerase catalytic subunit
Molecular weight formula_weight	86625.2 kDa
EC 编号 ec_number	2.7.7.48
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MDVNPTLLFLKVPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYSEKGRWTTNTETGAPQLNPIDGPLPEDNEPSGYAQTDCVLEAMAFLEESHPGIFENSCLETMEVVQQTRVDKLTQGRQTYDWTLNRNQPAATALANTIEVFRSNGLTANESGRLIDFLKDVMESMDKEEMEITTHFQRKRRVRDNMTKKMVTQRTIGKKKQRLNKRSYLIRALTLNTMTKDAERGKLKRRAIATPGMQIRGFVYFVETLARSICEKLEQSGLPVGGNEKKAKLANVVRKMMTNSQDTELSFTITGDNTKWNENQNPRMFLAMITYITRNQPEWFRNVLSIAPIMFSNKMARLGKGYMFESKSMKLRTQIPAEMLASIDLKYFNDSTRKKIEKIRPLLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQKRYTKTTYWWDGLQSSDDFALIVNAPNHEGIQAGVDRFYRTCKLLGINMSKKKSYINRTGTFEFTSFFYRYGFVANFSMELPSFGVSGINESADMSIGVTVIKNNMINNDLGPATAQMALQLFIKDYRYTYRCHRGDTQIQTRRSFEIKKLWEQTRSKAGLLVSDGGPNLYNIRNLHIPEVCLKWELMDEDYQGRLCNPLNPFVSHKEIESVNNAVMMPAHGPAKNMEYDAVATTHSWIPKRNRSILNTSQRGILEDEQMYQKCCNLFEKFFPSSSYRRPVGISSMVEAMVSRARIDARIDFESGRIKKEEFAEIMKICSTIEELRRQK

来源 Source

来源生物 organism	Influenza A virus (A/Brevig Mission/1/1918(H1N1))
NCBI Class编号 ncbi_taxonomy_id	88776
宿主生物 host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	Polymerase basic protein 2
Molecular weight formula_weight	86849.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITADKRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSAVHYPKIYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKISPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCWEQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQNPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSMRGVRVSKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEVNGPESVLVNTYQWIIRNWETVKIQWSQNPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLFQQMRDVLGTFDTVQIIKLLPFAAAPPKQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAINENLYFQ

来源 Source

来源生物 organism	Influenza A virus (A/Brevig Mission/1/1918(H1N1))
NCBI Class编号 ncbi_taxonomy_id	88776
宿主生物 host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	Nuclear export protein
Molecular weight formula_weight	15221.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

GPLGSPEFCMDSNTVSSFQDILMRMSKMQLGSSSEDLNGIITQFESLKLYRDSLGEAVMRMGDLHSLQNRNGKWREQLGQKFEEIRWLIEEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTFSFQLI

来源 Source

来源生物 organism	Influenza A virus (A/Brevig Mission/1/1918(H1N1))
NCBI Class编号 ncbi_taxonomy_id	88776
宿主生物 host_organism	Escherichia coli BL21(DE3)

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.93 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	35000

fit	/app/data/saxs_computation/ry/9ryc/9ryc.fit
pddf	/app/data/pr_computation/ry/9ryc/9ryc.pr.out
profile	/app/data/saxs_computation/ry/9ryc/9ryc.dat

Structure of human 1918 influenza A polymerase heterotrimer in complex with WSN NEP.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Polymerase acidic protein

State in the Current Structure

Other States of the Same Protein in the Database

RNA-directed RNA polymerase catalytic subunit

State in the Current Structure

Other States of the Same Protein in the Database

Polymerase basic protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Nuclear export protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)