9srd

Cryo-EM structure of P. abyssi 70S ribosome in complex with hibernation factor HibA (HibA-uL5 conformation)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S3Ae

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS3A_PYRAB
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AA； PDBConstruct 1–199； UniProt 1–199

30S ribosomal protein S2

OrganismNot specified

UniProt Q9V191

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS2_PYRAB
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AB； PDBConstruct 1–202； UniProt 1–202

Zn-ribbon RNA-binding protein involved in translation

OrganismNot specified

UniProt G8ZFK7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G8ZFK7_PYRAB
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AC； PDBConstruct 1–63； UniProt 1–63

30S ribosomal protein S4

OrganismNot specified

UniProt P61992

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS4_PYRAB
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AD； PDBConstruct 1–180； UniProt 1–180

30S ribosomal protein S4e

OrganismNot specified

UniProt Q9V1U8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS4E_PYRAB
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AE； PDBConstruct 1–243； UniProt 1–243

30S ribosomal protein S5

OrganismNot specified

UniProt Q9V1V5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS5_PYRAB
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain AF； PDBConstruct 1–236； UniProt 1–236

30S ribosomal protein S6e

OrganismNot specified

UniProt Q9UYS3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS6E_PYRAB
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain AG； PDBConstruct 1–125； UniProt 1–125

30S ribosomal protein S7

OrganismNot specified

UniProt Q9V109

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS7_PYRAB
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain AH； PDBConstruct 1–215； UniProt 1–215

30S ribosomal protein S8

OrganismNot specified

UniProt Q9V1V0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS8_PYRAB
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain AI； PDBConstruct 1–130； UniProt 1–130

30S ribosomal protein S8e

OrganismNot specified

UniProt Q9UZL4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS8E_PYRAB
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain AJ； PDBConstruct 1–127； UniProt 1–127

30S ribosomal protein S9

OrganismNot specified

UniProt Q9V195

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS9_PYRAB
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain AK； PDBConstruct 1–135； UniProt 1–135

30S ribosomal protein S10

OrganismNot specified

UniProt Q9V0V6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS10_PYRAB
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain AL； PDBConstruct 1–102； UniProt 1–102

30S ribosomal protein S11

OrganismNot specified

UniProt P62010

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS11_PYRAB
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain AM； PDBConstruct 1–137； UniProt 1–137

30S ribosomal protein S12

OrganismNot specified

UniProt P61994

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS12_PYRAB
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain AN； PDBConstruct 1–147； UniProt 1–147

30S ribosomal protein S14 type Z

OrganismNot specified

UniProt P62012

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS14Z_PYRAB
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain AP； PDBConstruct 1–56； UniProt 1–56

30S ribosomal protein S15

OrganismNot specified

UniProt Q9V2K9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS15_PYRAB
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain AQ； PDBConstruct 1–158； UniProt 1–158

30S ribosomal protein S17

OrganismNot specified

UniProt Q9V1U5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS17_PYRAB
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain AR； PDBConstruct 1–113； UniProt 1–113

30S ribosomal protein S17e

OrganismNot specified

UniProt Q9V0G0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS17E_PYRAB
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain AS； PDBConstruct 1–67； UniProt 1–67

30S ribosomal protein S19e

OrganismNot specified

UniProt Q9V0G8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS19E_PYRAB
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain AU； PDBConstruct 1–150； UniProt 1–150

30S ribosomal protein S24e

OrganismNot specified

UniProt Q9UY20

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS24_PYRAB
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain AV； PDBConstruct 1–99； UniProt 1–99 Author chain B6； PDBConstruct 1–99； UniProt 1–99

30S ribosomal protein S27e

OrganismNot specified

UniProt Q9UXZ3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS27_PYRAB
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain AW； PDBConstruct 1–65； UniProt 1–65

30S ribosomal protein S28e

OrganismNot specified

UniProt P61029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS28_PYRAB
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain AX； PDBConstruct 1–71； UniProt 1–71

30S ribosomal protein S27ae

OrganismNot specified

UniProt P61238

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS27A_PYRAB
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain AY； PDBConstruct 1–51； UniProt 1–51

30S ribosomal protein S3

OrganismNot specified

UniProt Q9V1U1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS3_PYRAB
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain AZ； PDBConstruct 1–210； UniProt 1–210

Small ribosomal subunit protein eS32

OrganismNot specified

UniProt Q8U232

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS32_PYRFU
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain A0； PDBConstruct 1–37； UniProt 1–37

50S ribosomal protein L7Ae

OrganismNot specified

UniProt P62008

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL7A_PYRAB
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain A3； PDBConstruct 1–123； UniProt 1–123 Author chain B4； PDBConstruct 1–123； UniProt 1–123 Author chain BG； PDBConstruct 1–123； UniProt 1–123

30S ribosomal protein S19

OrganismNot specified

UniProt Q9V1T9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS19_PYRAB
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain AT； PDBConstruct 1–132； UniProt 1–132

30S ribosomal protein S13

OrganismNot specified

UniProt Q9V1A0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS13_PYRAB
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain AO； PDBConstruct 1–148； UniProt 1–148

Large ribosomal subunit protein uL2

OrganismNot specified

UniProt Q9V1T8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL2_PYRAB
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain BB； PDBConstruct 1–239； UniProt 1–239

Large ribosomal subunit protein uL30

OrganismNot specified

UniProt Q9V1V6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL30_PYRAB
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain BY； PDBConstruct 1–155； UniProt 1–155

Large ribosomal subunit protein uL18

OrganismNot specified

UniProt Q9V1V4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18_PYRAB
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain BO； PDBConstruct 1–203； UniProt 1–203

Large ribosomal subunit protein uL3

OrganismNot specified

UniProt Q9V1T5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL3_PYRAB
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain BC； PDBConstruct 1–361； UniProt 1–361

Large ribosomal subunit protein eL14

OrganismNot specified

UniProt Q9UZJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL14E_PYRAB
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain B5； PDBConstruct 1–82； UniProt 1–82 Author chain BK； PDBConstruct 1–82； UniProt 1–82

Large ribosomal subunit protein uL15

OrganismNot specified

UniProt Q9V1V7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15_PYRAB
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain BL； PDBConstruct 1–147； UniProt 1–147

Large ribosomal subunit protein eL39

OrganismNot specified

UniProt Q9UYI8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL39_PYRAB
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain Bf； PDBConstruct 1–51； UniProt 1–51

Large ribosomal subunit protein uL24

OrganismNot specified

UniProt Q9V1U7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24_PYRAB
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain BU； PDBConstruct 1–121； UniProt 1–121

Large ribosomal subunit protein eL32

OrganismNot specified

UniProt Q9V1V2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL32_PYRAB
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain Bb； PDBConstruct 1–130； UniProt 1–130

Large ribosomal subunit protein eL37

OrganismNot specified

UniProt P62004

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL37_PYRAB
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain Be； PDBConstruct 1–62； UniProt 1–62

Large ribosomal subunit protein uL5

OrganismNot specified

UniProt Q9V1U9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL5_PYRAB
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain BE； PDBConstruct 1–188； UniProt 1–188

Large ribosomal subunit protein eL31

OrganismNot specified

UniProt Q9UYI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL31_PYRAB
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain Ba； PDBConstruct 1–94； UniProt 1–94

Large ribosomal subunit protein uL23

OrganismNot specified

UniProt Q9V1T7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL23_PYRAB
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain BT； PDBConstruct 1–86； UniProt 1–86

Large ribosomal subunit protein uL29

OrganismNot specified

UniProt Q9V1U2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL29_PYRAB
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain BW； PDBConstruct 1–68； UniProt 1–68

Large ribosomal subunit protein eL43

OrganismNot specified

UniProt Q9V202

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL37A_PYRAB
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain Bi； PDBConstruct 1–83； UniProt 1–83

Large ribosomal subunit protein uL13

OrganismNot specified

UniProt Q9V196

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL13_PYRAB
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain BI； PDBConstruct 1–142； UniProt 1–142

Large ribosomal subunit protein eL21

OrganismNot specified

UniProt Q9UZP1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL21_PYRAB
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain BR； PDBConstruct 1–97； UniProt 1–97

Large ribosomal subunit protein eL19

OrganismNot specified

UniProt Q9V1V3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL19E_PYRAB
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain BQ； PDBConstruct 1–151； UniProt 1–151

Large ribosomal subunit protein eL24

OrganismNot specified

UniProt Q9V0W3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24E_PYRAB
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain BV； PDBConstruct 1–67； UniProt 1–67

Large ribosomal subunit protein eL42

OrganismNot specified

UniProt Q9UXZ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL44E_PYRAB
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain Bj； PDBConstruct 1–94； UniProt 1–94

Large ribosomal subunit protein uL4

OrganismNot specified

UniProt Q9V1T6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL4_PYRAB
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain BD； PDBConstruct 1–255； UniProt 1–255

Large ribosomal subunit protein uL6

OrganismNot specified

UniProt Q9V1V1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL6_PYRAB
Isoform	—
PDB entities	53
Chains and sequence ranges	Author chain BF； PDBConstruct 1–184； UniProt 1–184

Large ribosomal subunit protein eL30

OrganismNot specified

UniProt Q9V112

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL30E_PYRAB
Isoform	—
PDB entities	54
Chains and sequence ranges	Author chain BZ； PDBConstruct 1–99； UniProt 1–99

Large ribosomal subunit protein eL18

OrganismNot specified

UniProt Q9V197

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18E_PYRAB
Isoform	—
PDB entities	55
Chains and sequence ranges	Author chain BP； PDBConstruct 1–120； UniProt 1–120

Large ribosomal subunit protein eL15

OrganismNot specified

UniProt Q9V0D2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15E_PYRAB
Isoform	—
PDB entities	56
Chains and sequence ranges	Author chain BM； PDBConstruct 1–194； UniProt 1–194

Large ribosomal subunit protein uL22

OrganismNot specified

UniProt Q9V1U0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL22_PYRAB
Isoform	—
PDB entities	57
Chains and sequence ranges	Author chain BS； PDBConstruct 1–155； UniProt 1–155

Large ribosomal subunit protein eL34

OrganismNot specified

UniProt Q9UZJ7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL34_PYRAB
Isoform	—
PDB entities	58
Chains and sequence ranges	Author chain Bd； PDBConstruct 1–91； UniProt 1–91

Large ribosomal subunit protein uL16

OrganismNot specified

UniProt Q9UYU9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL10E_PYRAB
Isoform	—
PDB entities	59
Chains and sequence ranges	Author chain BN； PDBConstruct 1–181； UniProt 1–181

Large ribosomal subunit protein eL40

OrganismNot specified

UniProt P62006

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL40_PYRAB
Isoform	—
PDB entities	60
Chains and sequence ranges	Author chain Bg； PDBConstruct 1–51； UniProt 1–51

Large ribosomal subunit protein eL33

OrganismNot specified

UniProt Q9V1P2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL35A_PYRAB
Isoform	—
PDB entities	61
Chains and sequence ranges	Author chain Bc； PDBConstruct 1–87； UniProt 1–87

Large ribosomal subunit protein uL14

OrganismNot specified

UniProt Q9V1U6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL14_PYRAB
Isoform	—
PDB entities	62
Chains and sequence ranges	Author chain BJ； PDBConstruct 1–141； UniProt 1–141

Large ribosomal subunit protein eL20

OrganismNot specified

UniProt Q9UYI5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） C2H2-type domain-containing protein × 1 （G8ZKB7） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18A_PYRAB
Isoform	—
PDB entities	63
Chains and sequence ranges	Author chain Bl； PDBConstruct 1–77； UniProt 1–77

C2H2-type domain-containing protein

OrganismNot specified

UniProt G8ZKB7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） Dehydrogenase × 1 （Q9UYR4） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G8ZKB7_PYRAB
Isoform	—
PDB entities	64
Chains and sequence ranges	Author chain Bk； PDBConstruct 1–65； UniProt 1–65

Dehydrogenase

OrganismNot specified

UniProt Q9UYR4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 66 RNA 3	rRNA 23S × 1 rRNA 16S × 1 rRNA 5S × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 2 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） Small ribosomal subunit protein eS32 × 1 （Q8U232） 50S ribosomal protein L7Ae × 3 （P62008） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S13 × 1 （Q9V1A0） Large ribosomal subunit protein uL2 × 1 （Q9V1T8） Large ribosomal subunit protein uL30 × 1 （Q9V1V6） Large ribosomal subunit protein uL18 × 1 （Q9V1V4） Large ribosomal subunit protein uL3 × 1 （Q9V1T5） Large ribosomal subunit protein eL14 × 2 （Q9UZJ5） Large ribosomal subunit protein uL15 × 1 （Q9V1V7） Large ribosomal subunit protein eL39 × 1 （Q9UYI8） Large ribosomal subunit protein uL24 × 1 （Q9V1U7） Large ribosomal subunit protein eL32 × 1 （Q9V1V2） Large ribosomal subunit protein eL37 × 1 （P62004） Large ribosomal subunit protein uL5 × 1 （Q9V1U9） Large ribosomal subunit protein eL31 × 1 （Q9UYI7） Large ribosomal subunit protein uL23 × 1 （Q9V1T7） Large ribosomal subunit protein uL29 × 1 （Q9V1U2） Large ribosomal subunit protein eL43 × 1 （Q9V202） Large ribosomal subunit protein uL13 × 1 （Q9V196） Large ribosomal subunit protein eL21 × 1 （Q9UZP1） Large ribosomal subunit protein eL19 × 1 （Q9V1V3） Large ribosomal subunit protein eL24 × 1 （Q9V0W3） Large ribosomal subunit protein eL42 × 1 （Q9UXZ2） Large ribosomal subunit protein uL4 × 1 （Q9V1T6） Large ribosomal subunit protein uL6 × 1 （Q9V1V1） Large ribosomal subunit protein eL30 × 1 （Q9V112） Large ribosomal subunit protein eL18 × 1 （Q9V197） Large ribosomal subunit protein eL15 × 1 （Q9V0D2） Large ribosomal subunit protein uL22 × 1 （Q9V1U0） Large ribosomal subunit protein eL34 × 1 （Q9UZJ7） Large ribosomal subunit protein uL16 × 1 （Q9UYU9） Large ribosomal subunit protein eL40 × 1 （P62006） Large ribosomal subunit protein eL33 × 1 （Q9V1P2） Large ribosomal subunit protein uL14 × 1 （Q9V1U6） Large ribosomal subunit protein eL20 × 1 （Q9UYI5） C2H2-type domain-containing protein × 1 （G8ZKB7） MAGNESIUM ION × 244 ZINC ION × 13	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9UYR4_PYRAB
Isoform	—
PDB entities	65
Chains and sequence ranges	Author chain H； PDBConstruct 1–392； UniProt 1–392

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9srd
Deposition date deposition_date	2025-09-24
Structure title title	Cryo-EM structure of P. abyssi 70S ribosome in complex with hibernation factor HibA (HibA-uL5 conformation)
Keywords keywords	70S, ribosome, Hibernation, Pyrococcus abyssi; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9srd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9srd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9srd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	86.72 Å
Rg (electron density)	88.05 Å
Total Rg	87.93 Å
Atom count	170227
Residues	13152
Excluded volume	2675300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9srd__assembly_1__model_1`	69-meric （69）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (67)

Entity 1 Entity 1 polymer

Description description	rRNA 23S
Molecular weight formula_weight	984301.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	1
Atom count atom_count	170227

CGAGGGCUCGGGUAGAAGACCNGGUUGAUGGGGCGGGGAUGUAAGCGGGAAGGGUCAACNGACCCGCUUAGUCUGCCGCCCCCAAUCGCCNGAGGUCCUGUCCCCCGAGGGGGUCAGGACACUAAGCCGCCNGGUGGAUGGCUCGGCUCGGGGCGCNGACGAAGGGCGUGGCAAGCUGCGAUAAGCCCCGGCGAGGCGCAGGCAGCNGUCGAACCGGGGAUUCCNGAAUGGGACCUCCNGCGGCUUAUGCCGCACUCCGGGGCAUAAGCCCCGGAGGGGGAACGCGGGGAAUUGAAACAUCUUAGUACCNGCAGGAAAAGAAAGCAAAAGCGAUGCNGUGAGUAGGGGCGACNGAAAGCGGCACAGGGCAAACUGAACCCCGGGCCGACGAGGUUCGGGGGAUGUGGGGUUGUAGGGCCCCCGUAUGAGACCCUCGCGGGUGAAGCNGAAGUCNGCUGGAACGCGGCGCCGGAGAGGGUGAUAGCCCCGUAGGCGUAAGCCCGCAGGGUCUCGGGGGACCCUGAGUACNGUCGGUUGGAUAUCCGGCGGGAAGCUGGGAGGCAUCGGCUCCCAACCCUAAAUACGUCCCGAGACCGAUAGCGAACUAGUACCGUGAGGGAAAGCUGAAAAGCACCCNGGGAGGGGGGUGAAAAGAGCCUGAAACCGGGCGGCGAUAGGAGGGUGCGGCCNGAAAGGAAUGAGCCUCCCCGAAGGAAACCGCGGCGACGCGGGAGUACGAGGGGAGGGGACCGGGGUUGCACCGUCCGUCUUGAAACACGGGGCAGGGAGUUCGCGGCNGUGGCGAGGUUAAGGGGGUUAAGCCCNGUAGCNGCAGGGAAACCGACAUGCCCGCAGCCGGGCCUCGAGCCCGGUGAGGGGCGGGGUGCGAAAGCGCCCGGAGUCACGGCCGCGAGACCNGAAACCGGUCGAUCUAGCCCGGGGCAGGGUGAAGUCCCUCAACAGAGGGAUGGAGGCCNGCUAGGGGUGCUGAUGUGCAGUUCGCUCCCGUGACCCCGGGCUAGGGGUGAAAGGCCAAUCGAGGCNGGAGAUAGCUGGUUCCNGCNGAAUCAUCCCGCAGGAUGGCCUCCCCGGAGGUAGGCGGUGGGGUAGAGCACUGAUUGGGGGUGCAGGGGGCGAAAGCCCCCGGCCCCCUGUCAAACUCCGAACCCACCGCCGCCGUAGAUGGGGGGAGUAGGGUGGCGGUGUAAGCCGUCCACNGAGAGGGGAACAACCCAGACNGGGGUUAAGGCCCCAAAGUGCCGGCUAAGUGUUACUCCAAAGGGUGUCCNGGGCCUUAGACAGCGGGGAGGUAGGCUUAGAAGCAGCCAUCCUUUAAAGAGUGCGUAACAGCUCACCCGUCGAGGUCCGGGGCCCCGAAAAUGGACGGGGCUCAAGCCGGCCGCCGAGACCCCGGCGCACGGACCGAUUGGUCCGUGAUCGGGUAGGCGGGCGUGCNGGUGGCGUAGAAGCCGGGCCGUAAGGUCCGGUGGAGCCGCCGGUAUCGCGGAUCCUGCCGGGAGUAGCAGCGUAGUCGGGUGAGAAUCCNGACNGCNGGAGGGGCCAGGGUUCCACAGGCAAUGGUCGUCAGCNGUGGGUUAGUCGGUCCUAACCCNGCCNGUAACUCGGCGCGGGGGAAAGGGAAACGGGUUAAUAUUCCNGUACNGCGGGGGUAGGUGCGGCAACGCAAGCCNGGAGGGUGACGCCUCGGGGUAGGCGGACCGGCCGAUGAGGCCGGCUAAGCGUAUAAGCCNGGGGAGUGCNGUAAUGGCGAGAACNGGGUGAAAGCGCGAAUGGCCCCCCCGUUAGGGGGGUUCCGCCGAUCCCUGGGGCCCGUGAAAAGCCCUCCGGGAAUUCCGAUCCCCNGCGACNGUACNGAGAACNGACACAGGUGCCCCUGGGUGAGAAGCCUAAGGCGUGUCGGGGGAAACCNGGCNGAGGGAACUCGGCAAACUGGCCCNGUAACUUCGGGAGAAGGGGUGCCUGCGGGUGCGUAACCNGCAGGUCGCAGUGACUAGGGGGGCCNGACUGUUUAAUAAAAACACAGGUCCCAGCUAGCCNGAAAGGGUUUGUACUGGGGCNGACGCCUGCCCAGUGCCGGUAUGUGAAGCCCGGGUACAACCGGGUGAAGCACNGGUAAACGGCGGGGGUAACUAUAACCCUCUUAAGGUAGCGAAAUUCCUUGUCGGUUAAAUGCCGACCUGCAUGAAUGGCGUAACGAGGUCCCCGCUGUCCCCGGCCGGGGCCNGGCGAAACCUCUGCCUGGCGCGCAUGCCAGGGACCCCNGGUGGGAAGCGAAGACCCCAUGGAGCUUUACUGCAGCCUGCNGUUGCCACGCGGCGGGGGGUGCGCAGCGUAGGCGGGAGGCGUCGAAGCCCGGCCUCCGGGUCGGGUGGAGCCGUCCAUGAGACACCGCCCACUCCUCGCCGCGUGGCUAACCCCCGAAAGGGGGGACAGCGGUAGGUGGGCAGUUUGGCUGGGGCGGCACGCCCCNGAAAAGGUAUCGGGGGCGCCCUAAGGUCGGCUCAGGCGGGUCAGGAAUCNGCNGUAGAGUGCAAGGGCAAAAGCNGGCCUGACUGGACCNGUAACAGAGGCGGGUCCAGCCCNGAAAGGGUGGCCUAGCGAACCCCUGUGCCUCCCNGGUGGGGGCCAGGGAUGACAGAAAAGCUACCCUGGGGAUAACAGAGUCGUCUCGGGCGAGAGCCCAUAUCGACCCNGAGGCUUGCUACCUCGCUGUCGGCUCUUCCCAUCCUGGCCCUGCAGCAGGGGCCAAGGGUGGGGGUGUUCACCCAUUAAAGGGGAACGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUCGGAUGCUAUCUACCGGGGGUGUUGGCNGCCUGAGGGGAAGGUGCCCUUAGUACGAGAGGAACAGGGCGCNGCGGCCUCUGGUCUACNGGUUGUCCUCCNGGGCAUCGCCGGGCAGCUACGCNGCAGCNGAUAAGGCCUGAAGGCAUCUAAGGCNGAAGCGGCCCCNGAAAAUAGGCGGCCGUUC

Entity 2 Entity 2 polymer

Description description	rRNA 16S
Molecular weight formula_weight	492728.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2

GGCCGUACUCCCUUAAUUCNGGUUGAUCCUGCCGGAGGCCACUGCUAUGGGGGUCNGACUAAGCCAUGCGAGUCAAGGGGGCGUCCCUUCUGGGACGCCACCGGCGGACGGCUCAGUAACACGUCGGUAACCUACCCUCGGGAGGGGGAUAACCCCGGGAAACUGGGGCUAAUCCCCCAUAGGCCUGGGGUACUGGAAGGUCCCCAGGCCGAAAGGGAGCCGUAAGGCUCCGCCCGAGGAUGGGCCGGCGGCCGAUUAGGUAGUUGGUGGGGUAACGGCCCACCAAGCNGAAGAUCGGUACGGGCNGUGAGAGCGGGAGCCNGGAGAUGGACACUGAGACACGGGUCCAGGCCCUACGGGGCGCAGCAGGCGCGAAACCUCNGCAAUGCGGGAAACNGCGACGGGGGGACCCCCAGUGCCGUGCCUCUGGCACGGCUUUUCCGGAGUGUAAAAAGCUCCGGGAAUAAGGGCUGGGCAAGGCNGGUGGCAGCCGCCGCGGUAAUACCGGCGGCCNGAGUGGUGGCCACUAUUAUUGGGCCUAAAGCGGCNGUAGCCGGGCCCGUAAGUCCCUGGCGAAAUCCCACGGCUCAACNGUGGGGCUCGCUGGGGAUACUGCGGGCCUUGGGACNGGGAGAGGCNGGGGGUACCCCCGGGGUAGGGGUGAAAUCCUAUAAUCCCGGGGGGACCGCCAGUGGCGAAGGCGCCNGGCUGGAACGGGUCNGACGGUGAGGGCNGAAGGCCAGGGGAGCGAACNGGAUUAGAUACCCGGGUAGUCCUGGCUGUAAAGGAUGCGGGCUAGGUGUCGGGCGAGCUUCGAGCUCGCCCGGUGCNGUAGGGAAGCNGUUAAGCCNGCNGCCUGGGGAGUACGGCNGCAAGGCUGAAACUUAAAGGAAUUGGCGGGGGAGCACUACAAGGGGUGGAGCGUGCGGUUUAAUUGGAUUCAACGCCGGGAACCUCACNGGGGGCGACGGCAGGAUGAAGGCCAGGCUGAAGGUCUUGCCGGACGCGCCGAGAGGAGGUGCAUGGCCGCNGUCAGCUCGUACCGUGAGGCGUCCACUUAAGUGUGGUAACGAGCGAGACCCGCGCCCCCAGUUGCCAGUCCCUCCCGCUCGGGAGGGAGGCACUCUGGGGGGACUGCCGGCGAUAAGCNGGAGGAAGGGGCGGGCGACGGUAGGUCAGUAUGCCCNGAAACCCCCGGGCUACACGCGCGCUACAAUGGGCGGGACAAUGGGUGCNGACCCNGAAAGGGGGAGGUAAUCCCCUAAACCCGCCCUCAGUUCGGAUCGCGGGCUGCAACUCGCCCGCGUGAAGCUGGAAUCCCUAGUACCCGCGCGUCAUCAUCGCGCGGCGAAUACGUCCCUGCUCCUUGCACACACCGCCCGUCACUCCACCCGAGCGGGGCCUAGGUGAGGCCCGAUCUCCUUCGGGAGGUCGGGUCGAGCCUAGGCUCCGUGAGGGGGGAGAAGUCGUAACAAGGUAGCNGUAGGGGAACCUACGGCUCGAUCACCUCCU

Entity 3 Entity 3 polymer

Description description	rRNA 5S
Molecular weight formula_weight	41443.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	3

ACGGCACGGCGGCCAUAGCGGGGGGGCCACACCNGGUCUCAUUUCGAACCCGGAAGUUAAGCCCCCCAGCGAUCCCGGUUGUACUGCCCUCCGAGAGGGGGCGGGAAGCCGGGGACGCCGCCGGCCAC

Entity 4 Entity 4 polymer

Description description	30S ribosomal protein S3Ae
Molecular weight formula_weight	22888.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA

MAAKRRVSAAKDKWKLKQWYVIYAPDFFGGVEVGLTPADDPEKVLNRVVEVTLKDITGDFLKGHVKLYFQVYDVKGQNAYTKFKGMKLARSYIRSLVRRRTTRIDGIFNITTKDGYKLRVMAMVIAARRIQTSQERAIRKIMQEIIYKKAEELNFKDFVLEAVNGKIAAEIAKEAKKIYPLKKAEIRKIKVLGEPEVAA

Entity 5 Entity 5 polymer

Description description	30S ribosomal protein S2
Molecular weight formula_weight	23026.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB

MADEYLVPLDQYLAAGVHIGTQQKTKDMKKFIYRVRQDGLYVLDVRKTDERLKVAGKFLARFDPQSILAVSVRLYGQKPVKKFGEVTGARAIPGRFLPGTMTNPAVKNFFEPDVIIITDPRADHQAMKEAIEIGIPIVALVDTENLLSYVDLAIPTNNKGRKALALIYWILAREILYNRGEISSREEFKIPVEEFEMKIVRR

Entity 6 Entity 6 polymer

Description description	Zn-ribbon RNA-binding protein involved in translation
Molecular weight formula_weight	7163.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC

MAENVELKFEIPVCTSCGREITPREHATHFVCPNCGEAIIWRCETCRLLAKPYKCPKCGWEGP

Entity 7 Entity 7 polymer

Description description	30S ribosomal protein S4
Molecular weight formula_weight	21381.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AD

MGDPKRQRKKYETPPHPWIKERLDRERVLMDKYELKNKKELWKHETQLKNFRRRARRLLAARGKQAEIEREQLLARLKRLGLLPEDAVLDDVLSLTIEDILERRLQTIVYKKGLARTMRQARQLIVHGHIEVNGQIIRSPSYLVLKEEEDTITYARTSPFANPQHPERMMIEKAKQGGEA

Entity 8 Entity 8 polymer

Description description	30S ribosomal protein S4e
Molecular weight formula_weight	28246.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AE

MARKGPKRHLKRLAAPTSWYIERKAYKWAVRPRPGPHNMRTSIPLLYIVRDYLGYAKTAREARKILNEGKFLVDGRVRKDYKFPVGIMDVVSIPETGEHYRVLPNRIGKLILHPISEEEANIKPLRIRNKRMVKGAKIQLNFHDGTNHLIPLSEKDNYFTSYTVLMKVPEREILEVLPFEKGAYVFVTQGKNVARKGRIVEIKKFPMGWPDVVTIEDEEGELFDTLKEYAFVVGRDKPRISLP

Entity 9 Entity 9 polymer

Description description	30S ribosomal protein S5
Molecular weight formula_weight	26523.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AF

MSQEWKEYAKRVLDEWQPKTKLGMLVKEGQITDIHEIFRKGYQIKEPEIIDVLLPEVNARENQEILDIALTVRMTDSGRRVRFRVLAAVGNRDGYVGLGIGHGREVGIAIRKAINYAKLNIIEIKRGCGSWECRCRRPHSVPFTVEGKEGSVRVKLIPGPRGLGLVIGDVGKKILRLAGIQDVWSQTLGETRTTVNFAKAVFNALYNTNKVVVTPEMIERYGIVVGRAMPASFTLE

Entity 10 Entity 10 polymer

Description description	30S ribosomal protein S6e
Molecular weight formula_weight	14029.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AG

MATFKLVISDPKTGIAKQIEITGPEAEKLIGKRIGDQIPVKELGINLNELFGKEFPEDVKMEIRGGTDKDGFPMRPDIHGPRRVRILLSKGPGFRPKEKGERRKKTVRGNTISPEIVQVNVKLVY

Entity 11 Entity 11 polymer

Description description	30S ribosomal protein S7
Molecular weight formula_weight	24662.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AH

MAKPLSERFFIPHEIKVMGRWSTEDVEVRDPSLKPYINLEPRLLPHTHGRHAKKHFGKANVHIVERLINKIMRSGGSHYKVAGHFMRREHRSLNSKKVKAYEVVKEAFKIIEKRTGKNPIQVLVWAIENAAPREDTTSVMFGGIRYHVAVDISPMRRLDVALRNIALGASAKCYRTKMSFAEALAEEIILAANKDPKSYAYSKKLEIERIAESSR

Entity 12 Entity 12 polymer

Description description	30S ribosomal protein S8
Molecular weight formula_weight	14772.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AI

MTLLDPLANALSHITNSERVGKREVYIKPASKLIGEVLRVMQKYGYIGEFEFIDDGRAGVYRVQLLGKINKAGAIKPRFPVKARDYERWEKRFLPAFEFGILIVSTSQGVMSHKEAREKGIGGRLIAYVY

Entity 13 Entity 13 polymer

Description description	30S ribosomal protein S8e
Molecular weight formula_weight	14293.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ

MAIWQGRSLRKPSGGRIVLARKKRKRELGREPSNTRVAEQDKRKIIRTYGGNKKVRLTAAAYANVFDKSGKGRKVRIIRVIENPANRQFARRNIITKGAIIETEIGKAKVTSRPGQDGVVNAILLEE

Entity 14 Entity 14 polymer

Description description	30S ribosomal protein S9
Molecular weight formula_weight	15293.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK

MRIIQTTGKRKTAIARAVIREGKGRVRINGKPVELVEPEIARFTILEPLILAGEEIWNSVDIDVKVQGGGFMGQAEAARIAIARALVEWTGDMNLKEKFIKYDRTMLVGDPRRTEPHKPNRSTKGPRAKRQKSYR

Entity 15 Entity 15 polymer

Description description	30S ribosomal protein S10
Molecular weight formula_weight	11795.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL

MQKARIKLASTNVRSLEEVANQIKQIAERTGVRMSGPIPLPTKRIRIVTRKSPDGEGSATFDRWELRIHKRLIDIEADERAMRQIMRIRVPEDVTIEIELIS

Entity 16 Entity 16 polymer

Description description	30S ribosomal protein S11
Molecular weight formula_weight	14773.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AM

MSEEQVNIKKKEKWGIAHIYSSYNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPKGGRRGRRV

Entity 17 Entity 17 polymer

Description description	30S ribosomal protein S12
Molecular weight formula_weight	16477.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AN

MPGKKAPNGEFAGRKLKLKRKKFRWSDIRYKRRVLRLKEKSDPLEGAPQARGIVLEKIAVEAKQPNSGMRKAVRVQLIKNGKVVTAFCPGDGAIKFIDEHDEVIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPRR

Entity 18 Entity 18 polymer

Description description	30S ribosomal protein S14 type Z
Molecular weight formula_weight	6644.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AP

MAKADYNKRKPRKFGKGARRCIRCGQYGPIIRIHGLMLCRHCFREVAPKLGFRKYE

Entity 19 Entity 19 polymer

Description description	30S ribosomal protein S15
Molecular weight formula_weight	18697.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AQ

MARMHARKRGKSGSKRPPRTAPPIWLEYTVEDIENLVVKLRKEGYSTAMIGTILRDQYGIPTVKLFRDPDNPNRKLTITRILEKHGLAPEIPEDLMFLIKRAVNLRKHLEQHPKDLHSMRGLQLIESKIRRLVKYYKRKGKLPKDWRYDPEQAKLLVR

Entity 20 Entity 20 polymer

Description description	30S ribosomal protein S17
Molecular weight formula_weight	13364.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AR

MVRDIGLRIQPPAEKCDDPKCPWHGHLKIHGRVFEGIVVSDKPRKTVTVERQYYHYLKKYERYELRRSRIHAHNPPCINAKVGDRVLIAETRPLSKTKHFVVVAVLERAEERR

Entity 21 Entity 21 polymer

Description description	30S ribosomal protein S17e
Molecular weight formula_weight	8059.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS

MGKIRQGFIKRVARELFNKYPNEFTRDFEHNKKKVEELTNVTSKKIRNRIAGYITKLVRMKEEGKIL

Entity 22 Entity 22 polymer

Description description	30S ribosomal protein S19e
Molecular weight formula_weight	17422.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AU

MATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTGRHKERLPEQEDWWYYRVASILRRVYLDGPVGIERLRTYYGGRKNRGHAPERFYKAGGSIIRKALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELKKELEEIIPELKKY

Entity 23 Entity 23 polymer

Description description	30S ribosomal protein S24e
Molecular weight formula_weight	11798.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AV,B6

MEIKITEVKENKLIGRKEIYFEIYHPGEPTPSRKDVKGKLVAMLDLNPETTVIQYIRSYFGSYKSKGYAKYYYDKDRMLYIEPEYILIRDGIIEKKEGE

Entity 24 Entity 24 polymer

Description description	30S ribosomal protein S27e
Molecular weight formula_weight	7186.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AW

MALPRNVIPMPRSRFLRVKCIDCGNEQIVFSHPATRVRCNVCGATLVEPTGGKGIIRAKILEVLE

Entity 25 Entity 25 polymer

Description description	30S ribosomal protein S28e
Molecular weight formula_weight	8102.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AX

MAEDEGYPAEVIEIIGRTGTTGDVTQVKVRILEGRDKGRVIRRNVRGPVRVGDILILRETEREAREIKSRR

Entity 26 Entity 26 polymer

Description description	30S ribosomal protein S27ae
Molecular weight formula_weight	5992.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AY

MGQKWKLYIVKDGKVIRKNKFCPRCGPGVFMADHGDRWACGRCGYTEWKKK

Entity 27 Entity 27 polymer

Description description	30S ribosomal protein S3
Molecular weight formula_weight	23472.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AZ

MAIERYFIREAVKEMLIDEFLEKELRRAGYGGLDIKKTPLGTKVIIFAANPGYVIGRGGRRIRELTRILERQFGLENPQIDVQEIKNPYLNAKVQAVRIAQALERGIHFRRAAYAAMRAIMSNGARGVEIRISGKLTGERAKSVRFYQGYLAKVGNPAETLVSKGYAQALLKLGVIGVKVAIMPPDARLPDEIEIIEKPVEEEVSSNEAE

Entity 28 Entity 28 polymer

Description description	Small ribosomal subunit protein eS32
Molecular weight formula_weight	5023.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A0

MKRRPRKWKKKGRMRWKWIKKRIRRLKRQRKKERGLI

Entity 29 Entity 29 polymer

Description description	50S ribosomal protein L7Ae
Molecular weight formula_weight	13442.7 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A3,BG,B4

MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK

Entity 30 Entity 30 polymer

Description description	30S ribosomal protein S19
Molecular weight formula_weight	15307.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AT

MARKEFRYRGYTLEQLMNMSLEELAKLLPARQRRSLKRGLTPEQKKLLRKIRLAKKGKYNKPIRTHCRDMIVLPEMVGLTIYVHNGKEFVPVEIKPEMIGHYLGEFAPTRKRVQHGAPGIGATRSSMFVAVK

Entity 31 Entity 31 polymer

Description description	30S ribosomal protein S13
Molecular weight formula_weight	16992.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AO

MADFRHIVRVAGVDLDGNKQLRWALTAIKGVGINFATMVCRVAGLDPFMKAGYLTDEQVKKIEEILQDPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAIREDIMRLRRIRAYRGIRHELGLPVRGQRTRSNFRRGQTVGVSRKKK

Entity 32 Entity 32 polymer

Description description	Large ribosomal subunit protein uL2
Molecular weight formula_weight	26202.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BB

MGKSLIQQRRGKGSPTFRSPSHRFRGAVKYIPLNYTQDKTLRGVVEEIMHDPGRTAPVARVRFENGMEKLIIAPEGLLVGQEIYIGPDAPIAIGNTLPLAKIPEGTYVYNIEGIPGDGGKYVRAGGTYALVVSREKDKVIVQLPSGELKAFNPNCRATIGVVAGGGRLEKPLVKAGKAYYKYKARNRFWPTPRGVKMNAVNHPFGGKEHHPGKPTTTSRRAPPGRKVGHIAARRTGRRK

Entity 33 Entity 33 polymer

Description description	Large ribosomal subunit protein uL30
Molecular weight formula_weight	17745.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BY

MAKLAVIRIRGRVNVKRPVRDTLAMLRLHRVNHCVIVDDTPSYLGMLQKAKDYITWGEINAETLAKLIRKRGRLIGNKPVTDEYVKEKLGMTIEEFAQKVINGEMSLKDLPNLKPVFRLHPPRGGFRGSKKRSFKEGGALGYRGEKINDLIERML

Entity 34 Entity 34 polymer

Description description	Large ribosomal subunit protein uL18
Molecular weight formula_weight	23308.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BO

MAHGPRYRVPFRRRREGKTNYRKRLKLLKSGKPRLVVRKSLNHHIAQIIVYDPKGDRTLVSAHTRELIRDFGWKGHCGNTPSAYLLGLLIGYKAKKAGIEEAILDIGLHPPVRGSSVFAVLKGAVDAGLNVPHSPEIFPEDYRIRGEHIAEYARMLKEQDEEKFRRQFGGYLEKGLDPEKLPEHFDEVKARIIEKFESEGARE

Entity 35 Entity 35 polymer

Description description	Large ribosomal subunit protein uL3
Molecular weight formula_weight	40928.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BC

MGKVHRPRRGSLAFSPRKRAKSIVPRIRSWPKETEVRMLGFAGYKAGMTHILMIDDEPGLTNGKEIFMPVTIIETPPLRVFGIRAYRQGYLGLETATEVIVPDFELDNYVSKKAKGRKFTFYQLLKRRIATLPKNYTKDDFEQKLGNLEDMIKEGEIVEVRALVATQPWVIKLKKKPEVMEYAIGGTSVEEKFNYIKEKLGKELRVGEVLKEGELLDVIAVTKGKGTQGPVKRWGIKLRAHKDSKGRRKVGSIGPWHPARVMWTVPMAGQMGFHHRTELNKRLIAIGENGKLVIDGNEIEITPKGGFPHYGIVRSDFMMIAGSVPGAIKRIIRVRPAIRPPKKKPPVQRPQITYVSVESKQ

Entity 36 Entity 36 polymer

Description description	Large ribosomal subunit protein eL14
Molecular weight formula_weight	8913.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B5,BK

MPAIDVGRIAVIIAGRRAGQKCVIVDIIDKNFVLVTGAGLNKVKRRRMNIKHLEPLPEKIDIPRGASDEEVKAALEKAGISL

Entity 37 Entity 37 polymer

Description description	Large ribosomal subunit protein uL15
Molecular weight formula_weight	16360.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BL

MIRRRKKVRKLRGSHTHGWGCKKKHRGGGSKGGRGMAGTGKRNKSKWTWTIKYAPDHLGKRGFSRPPEVQREVRTVTLKSIDENLDELLQKGIAYEEEGKIIVDTTQFADKVLGTGKITKPLVIKARAFSSKAEEKIKAAGGEAVLV

Entity 38 Entity 38 polymer

Description description	Large ribosomal subunit protein eL39
Molecular weight formula_weight	6316.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bf

MARNKPLAKKLRLAKAMKQNRRVPVWVIVKTNRRVLTHPKRRHWRRTKLKE

Entity 39 Entity 39 polymer

Description description	Large ribosomal subunit protein uL24
Molecular weight formula_weight	14420.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BU

MRLNSKQPRKQRKFLYNAPLHLRQKMMAAPLSKELREKYKIRNLPVRVGDKVRIMRGDFKGHEGKVVEVDLKRYRIYVEGATLRKTNGTEVFYPIHPSNVMIIELNLDDERRKKIIERRAG

Entity 40 Entity 40 polymer

Description description	Large ribosomal subunit protein eL32
Molecular weight formula_weight	15660.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bb

MDEKEFKRLLRVRARLKRKKPRFLRQEWWRYPKFKNDPKWRRPKGIDSKMRLKLKGKPRSPSIGWSSPRLVRGLHPSGYEEVLIHNVKELEKLDPKRQAARIAHTVGKKKRIEILKRAQELGIKVLNPQL

Entity 41 Entity 41 polymer

Description description	Large ribosomal subunit protein eL37
Molecular weight formula_weight	7321.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Be

MSSGTPSLGKRNKTPTHIRCRRCGRKAFNVKKGYCAACGFGRSRRLRKYRWSKKWKKKKNVH

Entity 42 Entity 42 polymer

Description description	Large ribosomal subunit protein uL5
Molecular weight formula_weight	21549.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BE

MAITIPNREEILADWEAHPMRKPRIEKVTINIGVGESGERLTKAEIMLERLTGQKPIRRKAKKTNRDFGIRRGEPIAVKVTLRGPKAYEMLKRLLAAVDNRLKASSFDEHGNVCFGIDEHINIPGVEYDPEIGIFGMDVCVTLERPGFRVARRKRKRAKIPTRHKLTKEEGMVYMMEEFGVEIVEEEG

Entity 43 Entity 43 polymer

Description description	Large ribosomal subunit protein eL31
Molecular weight formula_weight	11052.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ba

MPIKPGEEVIFTVPIRKIKKIVPRWKRAPRAVKFVREFVARHAKAQEVIISTKVNEKIWERGIEKPPSRLRVKVKVEEEDRDGKKVRIAYVDLA

Entity 44 Entity 44 polymer

Description description	Large ribosomal subunit protein uL23
Molecular weight formula_weight	9893.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BT

MDPYKVIIRPVITDKAISLIEKENKLTFIVDRRATKQDIKRAIEEIFNVKVEKVNTLITPKGEKKAYVKLKPEYSASEIAARLGLF

Entity 45 Entity 45 polymer

Description description	Large ribosomal subunit protein uL29
Molecular weight formula_weight	8182.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BW

MKPSEIREMSIEEIDAKIRELRLQLAKERGMLTMGTSLENPMVIRNLRRDIARLLTIKREKLREMRKK

Entity 46 Entity 46 polymer

Description description	Large ribosomal subunit protein eL43
Molecular weight formula_weight	9005.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bi

MSGTKKVGSAGRFGPRYGLKIRRRVAAVEAKMRQKHVCPVCGRRAVRRISTGIWQCKKCGAIFAGGAYLPVTPAGKVAKRVVE

Entity 47 Entity 47 polymer

Description description	Large ribosomal subunit protein uL13
Molecular weight formula_weight	16317.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BI

MRIINAEGLILGRLASRVAKMLLEGEEVVIVNAEKAVITGNREVIFSKYKQRTGLRTLTNPRRGPFYPKRSDEIVRRTIRGMLPWKTDRGRKAFKRLKVYVGIPKEFKDKQLETIVEAHVSRLSRPKYVTVGEVAKFLGGKF

Entity 48 Entity 48 polymer

Description description	Large ribosomal subunit protein eL21
Molecular weight formula_weight	11408.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BR

MVQKAHSFRRKTRKKLRKHPRRRGLPPLTRFLQEFEVGQRVHIVIEPSYHKGMPDPRFHGRTGTVVGKRGDAYIVEVPDGNKVKTLFIHPVHLRPQK

Entity 49 Entity 49 polymer

Description description	Large ribosomal subunit protein eL19
Molecular weight formula_weight	18240.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BQ

MKTLKMQRRVAAELLKCGENRIWIDPERVDDVASAITREDIRRLIKEGVIKKKPVKGQSRYRARIRHEQKKKGRHRGPGSRKGKKTARMGKKELWIKTIRALRKELRKLKEQKKIDRRTYRMLYIRAKGGQFKSKHQLYMFLEEHNLLKKR

Entity 50 Entity 50 polymer

Description description	Large ribosomal subunit protein eL24
Molecular weight formula_weight	8135.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BV

MARWNVCSYCGKPFEPGTGKMFVRNDGRVLFFCSRKCERYYFMGRNPRKLKWTKAYQEARLQRGIRK

Entity 51 Entity 51 polymer

Description description	Large ribosomal subunit protein eL42
Molecular weight formula_weight	11274.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bj

MKYPKQIRTYCPFCKRHTIHKVERVKKRPRSELSAGQRRFRRILKGYGGFPRPKPEGREKPVKKLDLRFRCTVCGKAHTRGRGFRVKKFELVEV

Entity 52 Entity 52 polymer

Description description	Large ribosomal subunit protein uL4
Molecular weight formula_weight	28758.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BD

MKVKVFDLNGQPVDEIELPKVFFTPFRPDLIRRAVIASWTHRIQPQGRDPMAGKRRVTENIGKGHGMARVERLKTPPRYAAFVPFARGGRRTHPPKVEKIIWEGINKKERRLAIMSAIAATANYDIVKARGHIIDNVPQLPLIVVDDLQKVSKTRETREIFKKLGIWDDIERAKEKTGIRAGKGKMRGRRYKKAKGPLIVVGKNEGIVFGARNHPGVDVVVVDNLGVEHLAPGTHPGRLTVWTVSAIERLKEIYG

Entity 53 Entity 53 polymer

Description description	Large ribosomal subunit protein uL6
Molecular weight formula_weight	20736.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BF

MPVDAWVREEIEIPEGVEVSVQGNTVKVKGPKGEVERELFWPGVKIFVEGGKVVIYKDFPRRKDVAIVRTFKAHINNMIKGVTEGFTYKLKVVYSHFPITVKVQGDEVIIENFLGEKAPRRAKILPGVTVKVKGQEIIVEGIDKEAVGQTAANIEQATRITKWDRRVFQDGIYIVEKAGKPITF

Entity 54 Entity 54 polymer

Description description	Large ribosomal subunit protein eL30
Molecular weight formula_weight	10751.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BZ

MDLAFELRKALETGKVILGSNETIRLAKTGGAKLIIVAKNAPKEIKDDIYYYAKLSDIPVYEFEGTSVELGTLLGKPFVVASLAIVDPGESRILALAKR

Entity 55 Entity 55 polymer

Description description	Large ribosomal subunit protein eL18
Molecular weight formula_weight	13839.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BP

MKRTGPTDPNLRRLIRYLRKKSNEEKVKIWKDIAWRLERPRRQRAEVNVSRINRYAKDGDMIVVPGSVLGAGKIEKKVIVAAWKFSETARRKIEEAGGEAITIEELIKRNPKGSGVIIME

Entity 56 Entity 56 polymer

Description description	Large ribosomal subunit protein eL15
Molecular weight formula_weight	22657.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BM

MGMYKYIREAWKSPKKSYVGQLLKQRMIKWRREPAVVRIERPTRLDRARALGYQAKQGYVIVRVRVRRGGRKRPRWKGGRKPSKMGQVKYSPKKSLQWIAEEKAARKFPNLEVLNSYWVGEDGMYKWFEVIMVDPHHPVIKSDPKIAWIALKHHKGRVFRGLTSAGKKGRGLRNKGKGAEKIRPSIRANEGKGK

Entity 57 Entity 57 polymer

Description description	Large ribosomal subunit protein uL22
Molecular weight formula_weight	17834.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BS

MGRRFDYSFQNFDPERMARASGRDLRISPKLAVEVCRELRGMMLNDALRYLDDVIALRRPVPLKRYNDSQGHKPGKGFGPGRYPVKVAKAIKKVLLNAQNNAKQKGLDPDKLRIIHIAAHRGPVLRGWYPRAFGRPTPFNEQTTHIEVVVEEVRR

Entity 58 Entity 58 polymer

Description description	Large ribosomal subunit protein eL34
Molecular weight formula_weight	10935.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bd

MKPMYRSRSWRRKYVRTPGGRVVIHFERRKPKIAHCAICGRPLNGIPRGRPVEMRKLPKTKKRPERPYPHLCPKCMRRVMKEQVRAQIMKG

Entity 59 Entity 59 polymer

Description description	Large ribosomal subunit protein uL16
Molecular weight formula_weight	20923.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BN

MALRPAKIDRYVDKPAYTRREYIRGAPGPKITIFDMGNPAGDFEFEVALHVSQPVQIRQNALEAARQQVNRYLQKNVGRSNYHFKIRVYPFQVLRENPMATGRKADRYGNGMRRPFGKPIGLAARLKKDQKVLSIRVNRQHLKFAIEGARRAAMKFPVKCYYRIYDKEGNDVTTKILSQGL

Entity 60 Entity 60 polymer

Description description	Large ribosomal subunit protein eL40
Molecular weight formula_weight	5900.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bg

MARFPEAEARIFKKYICLRCGATNPWGAEKCRKCGYKRLRPKAREPRGGGR

Entity 61 Entity 61 polymer

Description description	Large ribosomal subunit protein eL33
Molecular weight formula_weight	9755.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bc

MRIKGVVLSYRRSKENQHTNVMIIKPLNVNSREEASKLIGRLVIWKSPSGKLLKGKIVRVHGTKGAVRARFEKGLPGQALGDYVEII

Entity 62 Entity 62 polymer

Description description	Large ribosomal subunit protein uL14
Molecular weight formula_weight	15319.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BJ

MAKKGAGATRGITPVRPTRAIPVGAYLTVADNSGAKVIQVIGVVEYHGTRRRLASAGVGDMVVATVKKGRPDMRHQVVRAVIIRQRKEYRRLDGMRIKFEDNAAVIVTPEGVPRGTEIRGPVAREAAERWVRIGSIASIIV

Entity 63 Entity 63 polymer

Description description	Large ribosomal subunit protein eL20
Molecular weight formula_weight	9364.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bl

MNVKVFRVSGYFEKNGRKFKFTKEYRALKEEHVKELVYSDIGSKHKVKRRKIFIKEIKEIRPEEAEDIVVRRLSLEL

Entity 64 Entity 64 polymer

Description description	C2H2-type domain-containing protein
Molecular weight formula_weight	7795.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bk

MVRLKAIIVRDRDGEEFLRCPRCGMVFKRRKDYIKHVNKAHGWLFGRGKPKGKRLKKKYSKLLSQ

Entity 65 Entity 65 polymer

Description description	Dehydrogenase
Molecular weight formula_weight	44583.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MVGIQVQEVMTDRYAKIDINAPLSEAIGIIEKEDPDLILVFDDNVYKGVLTQDLIIRSHLKWDPTKAKVRDVYKPAPVVKPTDDLSHAAKLLLETDLRSLPVGENKAEILGVISDMALLERVVAEEFGKRKVEEFMTKDVITLGPDDTVAKALATMRDHGISRIPVVDEEGKLEGLVTLHDLIIRFIKPRFKAQYGELAGEKIPPFSMKLREAMIKGVITIMPEATIREAVSTMKDNNIDGLVVVDENNKVVGILTVKDLLLPISRMVEKEARFYLQLGGDASALSEFTRERIINDIKRFVDGYADLLGNEGIIYLYIRRFNEKFRGVHLYQARMRVVTDRGVFIARGETWGAIQAVHDAIRAIERQLLQKAELERDIRYAKRFIEKLELWR

Entity 66 Entity 66 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	244

Entity 67 Entity 67 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	13

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	2.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	207000

Cryo-EM structure of P. abyssi 70S ribosome in complex with hibernation factor HibA (HibA-uL5 conformation)

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S3Ae

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Zn-ribbon RNA-binding protein involved in translation

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S4e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S6e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S8e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer