← Back to search

9t8y

Crystal structure of beta-TrCP bound by monophosphorylated NRF2 degron peptide.

Method: X-RAY DIFFRACTION D_max: 72.5 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9t8y
deposition_date	2025-11-13
title	Crystal structure of beta-TrCP bound by monophosphorylated NRF2 degron peptide.
keywords	beta-TrCP, E3 ligase, phosphodegron, NRF2, LIGASE; LIGASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	21.82 Å
rg_electron	20.98 Å
i0	29281000.00
molecular_weight	40708.0 kDa
excluded_volume	50548 Å³
envelope_volume	58308 Å³
shell_volume	23207 Å³
envelope_diameter	72.9 Å
shell_rg	27.77 Å
envelope_rg	21.13 Å
shape_rg	20.98 Å
total_rg	21.80 Å
total_atoms	2857
n_residues	357
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	72.5 Å
rg_real	21.74 Å
rg_real_error	0.47 Å
i0_real	2.9280e+07
i0_real_error	3.5390e+05
rg_reciprocal	21.76 Å
i0_reciprocal	29280000.0000
total_estimate	0.8073
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	27.0 Å
skewness	0.285
kurtosis	-0.278
angular_range	— – 0.3650 Å⁻¹
current_alpha	0.0000
highest_alpha	9126000.0000
n_real_points	68
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.833; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.993; Smooth: 0.000

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	F-box/WD repeat-containing protein 1A
formula_weight	41829.7 kDa
mutation	L188E, L192E
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	3051

GSGMEWKKEIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLN

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Spodoptera frugiperda

Entity 2 polymer

description	Nuclear factor erythroid 2-related factor 2
formula_weight	1289.2 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

NDSDSGISLNTS

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	synthetic construct

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	186

▶

6. Citations (1)

▶

length_a	44.916 Å
length_b	47.090 Å
length_c	151.325 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 21 21 21
int_tables_number	19
crystal_system	—

resolution	1.795 Å
resolution_low	75.660 Å
r_factor	0.2005
r_work	0.1973
r_free	0.2647

fit	/app/data/saxs_computation/t8/9t8y/9t8y.fit
pddf	/app/data/pr_computation/t8/9t8y/9t8y.pr.out
profile	/app/data/saxs_computation/t8/9t8y/9t8y.dat

Crystal structure of beta-TrCP bound by monophosphorylated NRF2 degron peptide.

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)