← Back to search

9t95

Crystal structure of beta-TrCP bound by diphosphorylated NRF2 degron peptide.

Method: X-RAY DIFFRACTION D_max: 71.7 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9t95
deposition_date	2025-11-13
title	Crystal structure of beta-TrCP bound by diphosphorylated NRF2 degron peptide.
keywords	beta-TrCP, E3 ligase, phosphodegron, NRF2, LIGASE; LIGASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	21.82 Å
rg_electron	21.01 Å
i0	29487600.00
molecular_weight	40819.0 kDa
excluded_volume	50672 Å³
envelope_volume	58510 Å³
shell_volume	23178 Å³
envelope_diameter	72.6 Å
shell_rg	27.89 Å
envelope_rg	21.23 Å
shape_rg	21.00 Å
total_rg	21.86 Å
total_atoms	2863
n_residues	356
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	71.7 Å
rg_real	21.75 Å
rg_real_error	0.32 Å
i0_real	2.9490e+07
i0_real_error	3.4590e+05
rg_reciprocal	21.76 Å
i0_reciprocal	29490000.0000
total_estimate	0.8882
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	26.8 Å
skewness	0.290
kurtosis	-0.275
angular_range	— – 0.3650 Å⁻¹
current_alpha	0.0001
highest_alpha	9914000.0000
n_real_points	68
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.851; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.995; Smooth: 0.994

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	F-box/WD repeat-containing protein 1A
formula_weight	41829.7 kDa
mutation	L188E, L192E
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2997

GSGMEWKKEIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLN

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Spodoptera frugiperda

Entity 2 polymer

description	Nuclear factor erythroid 2-related factor 2
formula_weight	1369.1 kDa
src_method	syn
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

NDSDSGISLNTS

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	134

▶

6. Citations (1)

▶

length_a	45.060 Å
length_b	47.061 Å
length_c	150.461 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 21 21 21
int_tables_number	19
crystal_system	—

resolution	2.145 Å
resolution_low	75.230 Å
r_factor	0.1994
r_work	0.1956
r_free	0.2767

fit	/app/data/saxs_computation/t9/9t95/9t95.fit
pddf	/app/data/pr_computation/t9/9t95/9t95.pr.out
profile	/app/data/saxs_computation/t9/9t95/9t95.dat

Crystal structure of beta-TrCP bound by diphosphorylated NRF2 degron peptide.

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Entity 3 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)