← Back to search

9u66

Structure of HN HA at pH 6.4 (conformation3).

Method: ELECTRON MICROSCOPY D_max: 140.3 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9u66
deposition_date	2025-03-22
title	Structure of HN HA at pH 6.4 (conformation3).
keywords	Influenza, HA, cryo-EM, VIRAL PROTEIN; VIRAL PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	42.48 Å
rg_electron	42.02 Å
i0	414729000.00
molecular_weight	162520.0 kDa
excluded_volume	201680 Å³
envelope_volume	278770 Å³
shell_volume	57190 Å³
envelope_diameter	143.8 Å
shell_rg	44.96 Å
envelope_rg	41.91 Å
shape_rg	42.04 Å
total_rg	42.13 Å
total_atoms	11443
n_residues	1434
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	140.3 Å
rg_real	42.71 Å
rg_real_error	1.66 Å
i0_real	4.1470e+08
i0_real_error	7.4170e+06
rg_reciprocal	42.48 Å
i0_reciprocal	414600000.0000
total_estimate	0.8258
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	45.5 Å
skewness	0.519
kurtosis	-0.342
angular_range	— – 0.1850 Å⁻¹
current_alpha	0.0000
highest_alpha	45540000.0000
n_real_points	38
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.772; Stabil: 0.995; Sysdev: 1.000; Positv: 1.000; Valcen: 0.982; Smooth: 0.448

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Hemagglutinin
formula_weight	36428.9 kDa
src_method	man
entity_count	3

Polymer

type	polypeptide(L)
strand_id	E,A,C
atom_count	11443

DTICVGYHANNSTDTVDTILEKNVTVTHSVNLLEDSHNGKLCSLNGKIPLQLGNCNVAGWILGNPKCDLLLTANSWSYIIETSNSKNGACYPGEFADYEELKEQLSTVSSFERFEIFPKATSWPNHDTTRGTTVSCSHSGANSFYRNLLWIVKKGNSYPKLSKSYTNNKGKEVLVIWGVHHPPTDSDQQTLYQNNNTYVSVGSTKYYKRFTPEIVARPKVREQAGRMNYYWTLLDQGDTITFEATGNLIAPWHAFALKKGSSSGIMRSDAQVHNCTTKCQTPHGALKGNLPFQNVHPVTIGKCPKYVKSTQLRLATGLRNIPSIQSR

Source

organism	Influenza A virus
ncbi_taxonomy_id	11320
host_organism	Homo sapiens

Entity 2 polymer

description	Hemagglutinin
formula_weight	25067.3 kDa
src_method	man
entity_count	3

Polymer

type	polypeptide(L)
strand_id	F,B,D

GLFGAIAGFIEGGWTGMVDGWYGYHHRNEQGSGYAADQKSTQIAIDGISNKVNSVIEKMNIQFTSVGKEFNSLEKRMENLNKKVDDGFLDVWTYNAELLILLENERTLDFHDLNVKNLYEKVKSQLRNNAKEIGNGCFEFYHKCDNECMESVKNGTYNYPKYSEESKLNREEIDGVKLESMGIHQILAIYSTVASSLVLLVSLGAISFWMCSNGSLQCRVCI

Source

organism	Influenza A virus
ncbi_taxonomy_id	11320
host_organism	Homo sapiens

Entity 3 non-polymer

description	2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	221.2 kDa
src_method	syn
entity_count	5

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	3.49 Å
resolution_method	—
num_particles	18756

fit	/app/data/saxs_computation/u6/9u66/9u66.fit
pddf	/app/data/pr_computation/u6/9u66/9u66.pr.out
profile	/app/data/saxs_computation/u6/9u66/9u66.dat

Structure of HN HA at pH 6.4 (conformation3).

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

EM 3D

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 non-polymer

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)