9uha

human Ribonuclease MRP state 2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribonucleases P/MRP protein subunit POP1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	RNA (270-MER) × 1 Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） UPF0711 protein C18orf21 × 1 （Q32NC0） Ribonuclease P protein subunit p40 × 1 （O75818） Nucleolus and neural progenitor protein × 1 （Q6NW34） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1024； UniProt 1–1024

Ribonuclease P protein subunit p38

OrganismNot specified

UniProt P78345

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	RNA (270-MER) × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） UPF0711 protein C18orf21 × 1 （Q32NC0） Ribonuclease P protein subunit p40 × 1 （O75818） Nucleolus and neural progenitor protein × 1 （Q6NW34） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP38_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–283； UniProt 1–283

Ribonuclease P protein subunit p29

OrganismNot specified

UniProt O95707

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	RNA (270-MER) × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） UPF0711 protein C18orf21 × 1 （Q32NC0） Ribonuclease P protein subunit p40 × 1 （O75818） Nucleolus and neural progenitor protein × 1 （Q6NW34） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP29_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–220； UniProt 1–220

Ribonuclease P/MRP protein subunit POP5

OrganismNot specified

UniProt Q969H6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	RNA (270-MER) × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） UPF0711 protein C18orf21 × 1 （Q32NC0） Ribonuclease P protein subunit p40 × 1 （O75818） Nucleolus and neural progenitor protein × 1 （Q6NW34） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP5_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–163； UniProt 1–163

Ribonuclease P protein subunit p25

OrganismNot specified

UniProt Q9BUL9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	RNA (270-MER) × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） UPF0711 protein C18orf21 × 1 （Q32NC0） Ribonuclease P protein subunit p40 × 1 （O75818） Nucleolus and neural progenitor protein × 1 （Q6NW34） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP25_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–199； UniProt 1–199

Ribonuclease P protein subunit p20

OrganismNot specified

UniProt O75817

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	RNA (270-MER) × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） UPF0711 protein C18orf21 × 1 （Q32NC0） Ribonuclease P protein subunit p40 × 1 （O75818） Nucleolus and neural progenitor protein × 1 （Q6NW34） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP7_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–140； UniProt 1–140

Ribonuclease P protein subunit p14

OrganismNot specified

UniProt O95059

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	RNA (270-MER) × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p30 × 2 （P78346） UPF0711 protein C18orf21 × 1 （Q32NC0） Ribonuclease P protein subunit p40 × 1 （O75818） Nucleolus and neural progenitor protein × 1 （Q6NW34） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP14_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–124； UniProt 1–124

Ribonuclease P protein subunit p30

OrganismNot specified

UniProt P78346

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	RNA (270-MER) × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） UPF0711 protein C18orf21 × 1 （Q32NC0） Ribonuclease P protein subunit p40 × 1 （O75818） Nucleolus and neural progenitor protein × 1 （Q6NW34） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP30_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–268； UniProt 1–268 Author chain J； PDBConstruct 1–268； UniProt 1–268

UPF0711 protein C18orf21

OrganismNot specified

UniProt Q32NC0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	RNA (270-MER) × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） Ribonuclease P protein subunit p40 × 1 （O75818） Nucleolus and neural progenitor protein × 1 （Q6NW34） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CR021_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–220； UniProt 1–220

Ribonuclease P protein subunit p40

OrganismNot specified

UniProt O75818

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	RNA (270-MER) × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） UPF0711 protein C18orf21 × 1 （Q32NC0） Nucleolus and neural progenitor protein × 1 （Q6NW34） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP40_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–363； UniProt 1–363

Nucleolus and neural progenitor protein

OrganismNot specified

UniProt Q6NW34

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	RNA (270-MER) × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） UPF0711 protein C18orf21 × 1 （Q32NC0） Ribonuclease P protein subunit p40 × 1 （O75818） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NEPRO_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain M； PDBConstruct 1–567； UniProt 1–567

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9uha
Deposition date deposition_date	2025-04-14
Structure title title	human Ribonuclease MRP state 2
Keywords keywords	RNase MRP, RNA BINDING PROTEIN/RNA, RNA BINDING PROTEIN-RNA complex; RNA BINDING PROTEIN/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9uha__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9uha__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9uha__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	54.34 Å
Rg (electron density)	54.77 Å
Total Rg	54.87 Å
Atom count	27442
Residues	3011
Excluded volume	472230 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9uha__assembly_1__model_1`	13-meric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	RNA (270-MER)
Molecular weight formula_weight	86578.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	27442

UGGUUCGUGCUGAAGGCCUGUAUCCUAGGCUACACACUGAGGACUCUGUUCCUCCCCUUUCCGCCUAGGGGAAAGUCCCCGGACCUCGGGCAGAGAGUGCCACGUGCAUACGCACGUAGACAUUCCCCGCUUCCCACUCCAAAGUCCGCCAAGAAGCGUAUCCCGCUGAGCGGCGUGGCGCGGGGGCGUCAUCCGUCAGCUCCCUCUAGUUACGCAGGCAGUGCGUGUCCGCGCACCAACCACACGGGGCUCAUUCUCAGCGCGGCUGUU

Entity 2 Entity 2 polymer

Description description	Ribonucleases P/MRP protein subunit POP1
Molecular weight formula_weight	114896.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSNAKERKHAKKMRNQPTNVTLSSGFVADRGVKHHSGGEKPFQAQKQEPHPGTSRQRQTRVNPHSLPDPEVNEQSSSKGMFRKKGGWKAGPEGTSQEIPKYITASTFAQARAAEISAMLKAVTQKSSNSLVFQTLPRHMRRRAMSHNVKRLPRRLQEIAQKEAEKAVHQKKEHSKNKCHKARRCHMNRTLEFNRRQKKNIWLETHIWHAKRFHMVKKWGYCLGERPTVKSHRACYRAMTNRCLLQDLSYYCCLELKGKEEEILKALSGMCNIDTGLTFAAVHCLSGKRQGSLVLYRVNKYPREMLGPVTFIWKSQRTPGDPSESRQLWIWLHPTLKQDILEEIKAACQCVEPIKSAVCIADPLPTPSQEKSQTELPDEKIGKKRKRKDDGENAKPIKKIIGDGTRDPCLPYSWISPTTGIIISDLTMEMNRFRLIGPLSHSILTEAIKAASVHTVGEDTEETPHRWWIETCKKPDSVSLHCRQEAIFELLGGITSPAEIPAGTILGLTVGDPRINLPQKKSKALPNPEKCQDNEKVRQLLLEGVPVECTHSFIWNQDICKSVTENKISDQDLNRMRSELLVPGSQLILGPHESKIPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRRPPAKRPNYVKLGTLAPFCCPWEQLTQDWESRVQAYEEPSVASSPNGKESDLRRSEVPCAPMPKKTHQPSDEVGTSIEHPREAEEVMDAGCQESAGPERITDQEASENHVAATGSHLCVLRSRKLLKQLSAWCGPSSEDSRGGRRAPGRGQQGLTREACLSILGHFPRALVWVSLSLLSKGSPEPHTMICVPAKEDFLQLHEDWHYCGPQESKHSDPFRSKILKQKEKKKREKRQKPGRASSDGPAGEEPVAGQEALTLGLWSGPLPRVTLHCSRTLLGFVTQGDFSMAVGCGEALGFVSLTGLLDMLSSQPAAQRGLVLLRPPASLQYRFARIAIEV

Entity 3 Entity 3 polymer

Description description	Ribonuclease P protein subunit p38
Molecular weight formula_weight	31891.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAAAPQAPGRGSLRKTRPLVVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEVTRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLALAFKKNTTDFVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLSKPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKATPK

Entity 4 Entity 4 polymer

Description description	Ribonuclease P protein subunit p29
Molecular weight formula_weight	25474.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLEYFTRHKRKEKKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL

Entity 5 Entity 5 polymer

Description description	Ribonuclease P/MRP protein subunit POP5
Molecular weight formula_weight	18844.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCRKEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQKSVTRSCLLEEEEESGEEAAEAME

Entity 6 Entity 6 polymer

Description description	Ribonuclease P protein subunit p25
Molecular weight formula_weight	20659.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MENFRKVRSEEAPAGCGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQPATRAIVFSGCGRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLPPGPTQGQTPGEPAASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEPGVADEDQTA

Entity 7 Entity 7 polymer

Description description	Ribonuclease P protein subunit p20
Molecular weight formula_weight	15672.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK

Entity 8 Entity 8 polymer

Description description	Ribonuclease P protein subunit p14
Molecular weight formula_weight	13707.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAILRICSSGLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRELVLD

Entity 9 Entity 9 polymer

Description description	Ribonuclease P protein subunit p30
Molecular weight formula_weight	29364.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J

MAVFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKQEIEKPVAVSELFTTLPIVQGKSRPIKILTRLTIIVSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHLDVDLVCITVTEKLPFYFKRPPINVAIDRGLAFELVYSPAIKDSTMRRYTISSALNLMQICKGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG

Entity 10 Entity 10 polymer

Description description	UPF0711 protein C18orf21
Molecular weight formula_weight	24876.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MRQKHYLEAAARGLHDSCPGQARYLLWAYTSSHDDKSTFEETCPYCFQLLVLDNSRVRLKPKARLTPKIQKLLNREARNYTLSFKEAKMVKKFKDSKSVLLITCKTCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTPERRTANPNHDMSGSKGKSPASVFRTPTSGQSVSTCSSKNTSKTKKHFSQLKMLLSQNESQKIPKVDFRNFLSSLKGGLLK

Entity 11 Entity 11 polymer

Description description	Ribonuclease P protein subunit p40
Molecular weight formula_weight	41884.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLVMNTGPYYFVKNLPLHELITPEFISTFIKKGSCYALTYNTHIDEDNTVALLPNGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP

Entity 12 Entity 12 polymer

Description description	Nucleolus and neural progenitor protein
Molecular weight formula_weight	64653.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MMAAVPPGLEPWNRVRIPKAGNRSAVTVQNPGAALDLCIAAVIKECHLVILSLKSQTLDAETDVLCAVLYSNHNRMGRHKPHLALKQVEQCLKRLKNMNLEGSIQDLFELFSSNENQPLTTKVCVVPSQPVVELVLMKVLGACKLLLRLLDCCCKTFLLTVKHLGLQEFIILNLVMVGLVSRLWVLYKGVLKRLILLYEPLFGLLQEVARIQPMPYFKDFTFPSDITEFLGQPYFEAFKKKMPIAFAAKGINKLLNKLFLINEQSPRASEETLLGISKKAKQMKINVQNNVDLGQPVKNKRVFKEESSEFDVRAFCNQLKHKATQETSFDFKCSQSRLKTTKYSSQKVIGTPHAKSFVQRFREAESFTQLSEEIQMAVVWCRSKKLKAQAIFLGNKLLKSNRLKHLEAQGTSLPKKLECIKTSICNHLLRGSGIKTSKHHLRQRRSQNKFLRRQRKPQRKLQSTLLREIQQFSQGTRKSATDTSAKWRLSHCTVHRTDLYPNSKQLLNSGVSMPVIQTKEKMIHENLRGIHENETDSWTVMQINKNSTSGTIKETDDIDDIFALMGV

Entity 13 Entity 13 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.930 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.93 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	294518

human Ribonuclease MRP state 2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribonucleases P/MRP protein subunit POP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p38

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p29

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P/MRP protein subunit POP5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p25

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p20

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p30

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

UPF0711 protein C18orf21

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p40

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer