6ahu

Cryo-EM structure of human Ribonuclease P with mature tRNA

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribonucleases P/MRP protein subunit POP1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 2	H1 RNA × 1 Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） Ribonuclease P protein subunit p21 × 1 （Q9H633） Ribonuclease P protein subunit p40 × 1 （O75818） tRNA × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1024； UniProt 1–1024

Ribonuclease P protein subunit p38

OrganismNot specified

UniProt P78345

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 2	H1 RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） Ribonuclease P protein subunit p21 × 1 （Q9H633） Ribonuclease P protein subunit p40 × 1 （O75818） tRNA × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP38_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–283； UniProt 1–283

Ribonuclease P protein subunit p29

OrganismNot specified

UniProt O95707

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 2	H1 RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） Ribonuclease P protein subunit p21 × 1 （Q9H633） Ribonuclease P protein subunit p40 × 1 （O75818） tRNA × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP29_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–220； UniProt 1–220

Ribonuclease P/MRP protein subunit POP5

OrganismNot specified

UniProt Q969H6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 2	H1 RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） Ribonuclease P protein subunit p21 × 1 （Q9H633） Ribonuclease P protein subunit p40 × 1 （O75818） tRNA × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP5_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–163； UniProt 1–163

Ribonuclease P protein subunit p25

OrganismNot specified

UniProt Q9BUL9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 2	H1 RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） Ribonuclease P protein subunit p21 × 1 （Q9H633） Ribonuclease P protein subunit p40 × 1 （O75818） tRNA × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP25_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–199； UniProt 1–199

Ribonuclease P protein subunit p20

OrganismNot specified

UniProt O75817

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 2	H1 RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） Ribonuclease P protein subunit p21 × 1 （Q9H633） Ribonuclease P protein subunit p40 × 1 （O75818） tRNA × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP7_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–140； UniProt 1–140

Ribonuclease P protein subunit p14

OrganismNot specified

UniProt O95059

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 2	H1 RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p30 × 2 （P78346） Ribonuclease P protein subunit p21 × 1 （Q9H633） Ribonuclease P protein subunit p40 × 1 （O75818） tRNA × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP14_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–124； UniProt 1–124

Ribonuclease P protein subunit p30

OrganismNot specified

UniProt P78346

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 2	H1 RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p21 × 1 （Q9H633） Ribonuclease P protein subunit p40 × 1 （O75818） tRNA × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP30_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–268； UniProt 1–268 Author chain J； PDBConstruct 1–268； UniProt 1–268

Ribonuclease P protein subunit p21

OrganismNot specified

UniProt Q9H633

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 2	H1 RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） Ribonuclease P protein subunit p40 × 1 （O75818） tRNA × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP21_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–154； UniProt 1–154

Ribonuclease P protein subunit p40

OrganismNot specified

UniProt O75818

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 2	H1 RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （Q99575） Ribonuclease P protein subunit p38 × 1 （P78345） Ribonuclease P protein subunit p29 × 1 （O95707） Ribonuclease P/MRP protein subunit POP5 × 1 （Q969H6） Ribonuclease P protein subunit p25 × 1 （Q9BUL9） Ribonuclease P protein subunit p20 × 1 （O75817） Ribonuclease P protein subunit p14 × 1 （O95059） Ribonuclease P protein subunit p30 × 2 （P78346） Ribonuclease P protein subunit p21 × 1 （Q9H633） tRNA × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP40_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–363； UniProt 1–363

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ahu
Deposition date deposition_date	2018-08-20
Structure title title	Cryo-EM structure of human Ribonuclease P with mature tRNA
Keywords keywords	Ribonuclease P, RNA-protein complex, HYDROLASE-RNA complex; HYDROLASE/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ahu__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ahu__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ahu__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.86 Å
Rg (electron density)	53.11 Å
Total Rg	53.27 Å
Atom count	29386
Residues	3008
Excluded volume	493630 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ahu__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	H1 RNA
Molecular weight formula_weight	110244.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	29386

AUAGGGCGGAGGGAAGCUCAUCAGUGGGGCCACGAGCUGAGUGCGUCCUGUCACUCCACUCCCAUGUCCCUUGGGAAGGUCUGAGACUAGGGCCAGAGGCGGCCCUAACAGGGCUCUCCCUGAGCUUCGGGGAGGUGAGUUCCCAGAGAACGGGGCUCCGCGCGAGGUCAGACUGGGCAGGAGAUGCCGUGGACCCCGCCCUUCGGGGAGGGGCCCGGCGGAUGCCUCCUUUGCCGGAGCUUGGAACAGACUCACGGCCAGCGAAGUGAGUUCAAUGGCUGAGGUGAGGUACCCCGCAGGGGACCUCAUAACCCAAUUCAGACUACUCUCCUCCGCCCAUU

Entity 2 Entity 2 polymer

Description description	Ribonucleases P/MRP protein subunit POP1
Molecular weight formula_weight	114896.1 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSNAKERKHAKKMRNQPTNVTLSSGFVADRGVKHHSGGEKPFQAQKQEPHPGTSRQRQTRVNPHSLPDPEVNEQSSSKGMFRKKGGWKAGPEGTSQEIPKYITASTFAQARAAEISAMLKAVTQKSSNSLVFQTLPRHMRRRAMSHNVKRLPRRLQEIAQKEAEKAVHQKKEHSKNKCHKARRCHMNRTLEFNRRQKKNIWLETHIWHAKRFHMVKKWGYCLGERPTVKSHRACYRAMTNRCLLQDLSYYCCLELKGKEEEILKALSGMCNIDTGLTFAAVHCLSGKRQGSLVLYRVNKYPREMLGPVTFIWKSQRTPGDPSESRQLWIWLHPTLKQDILEEIKAACQCVEPIKSAVCIADPLPTPSQEKSQTELPDEKIGKKRKRKDDGENAKPIKKIIGDGTRDPCLPYSWISPTTGIIISDLTMEMNRFRLIGPLSHSILTEAIKAASVHTVGEDTEETPHRWWIETCKKPDSVSLHCRQEAIFELLGGITSPAEIPAGTILGLTVGDPRINLPQKKSKALPNPEKCQDNEKVRQLLLEGVPVECTHSFIWNQDICKSVTENKISDQDLNRMRSELLVPGSQLILGPHESKIPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRRPPAKRPNYVKLGTLAPFCCPWEQLTQDWESRVQAYEEPSVASSPNGKESDLRRSEVPCAPMPKKTHQPSDEVGTSIEHPREAEEVMDAGCQESAGPERITDQEASENHVAATGSHLCVLRSRKLLKQLSAWCGPSSEDSRGGRRAPGRGQQGLTREACLSILGHFPRALVWVSLSLLSKGSPEPHTMICVPAKEDFLQLHEDWHYCGPQESKHSDPFRSKILKQKEKKKREKRQKPGRASSDGPAGEEPVAGQEALTLGLWSGPLPRVTLHCSRTLLGFVTQGDFSMAVGCGEALGFVSLTGLLDMLSSQPAAQRGLVLLRPPASLQYRFARIAIEV

Entity 3 Entity 3 polymer

Description description	Ribonuclease P protein subunit p38
Molecular weight formula_weight	31891.4 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAAAPQAPGRGSLRKTRPLVVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEVTRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLALAFKKNTTDFVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLSKPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKATPK

Entity 4 Entity 4 polymer

Description description	Ribonuclease P protein subunit p29
Molecular weight formula_weight	25474.9 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLEYFTRHKRKEKKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL

Entity 5 Entity 5 polymer

Description description	Ribonuclease P/MRP protein subunit POP5
Molecular weight formula_weight	18844.7 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCRKEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQKSVTRSCLLEEEEESGEEAAEAME

Entity 6 Entity 6 polymer

Description description	Ribonuclease P protein subunit p25
Molecular weight formula_weight	20659.4 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MENFRKVRSEEAPAGCGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQPATRAIVFSGCGRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLPPGPTQGQTPGEPAASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEPGVADEDQTA

Entity 7 Entity 7 polymer

Description description	Ribonuclease P protein subunit p20
Molecular weight formula_weight	15672.9 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK

Entity 8 Entity 8 polymer

Description description	Ribonuclease P protein subunit p14
Molecular weight formula_weight	13707.0 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAILRICSSGLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRELVLD

Entity 9 Entity 9 polymer

Description description	Ribonuclease P protein subunit p30
Molecular weight formula_weight	29364.3 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J

MAVFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKQEIEKPVAVSELFTTLPIVQGKSRPIKILTRLTIIVSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHLDVDLVCITVTEKLPFYFKRPPINVAIDRGLAFELVYSPAIKDSTMRRYTISSALNLMQICKGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG

Entity 10 Entity 10 polymer

Description description	Ribonuclease P protein subunit p21
Molecular weight formula_weight	17596.1 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ

Entity 11 Entity 11 polymer

Description description	Ribonuclease P protein subunit p40
Molecular weight formula_weight	41884.8 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLVMNTGPYYFVKNLPLHELITPEFISTFIKKGSCYALTYNTHIDEDNTVALLPNGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP

Entity 12 Entity 12 polymer

Description description	tRNA
Molecular weight formula_weight	23168.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	T

GUUUCCGUAGUGUAGUGGUUAUCACGUUCGCCUAACACGCGAAAGGUCCCCGGUUCGAAACCGGGCGGAAAC

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 13 Entity 13 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	6ahuH01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	3250 — Ribonuclease P, Pop5 subunit

Domain ID domain_id	6ahuI01
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	140 — Metal-dependent hydrolases

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.66 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	287700

Cryo-EM structure of human Ribonuclease P with mature tRNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribonucleases P/MRP protein subunit POP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p38

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p29

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P/MRP protein subunit POP5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p25

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p20

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p30

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p21

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit p40

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer