SAXSdb — 9uxl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DUF3732 domain-containing protein

Vibrio cholerae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Lamassu C × 1 （A0A655W4S5） ABC-three component systems C-terminal domain-containing protein × 1 （A0A060KT36）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A060KSR0_VIBCL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–655； UniProt 1–653 Author chain F； PDBConstruct 3–655； UniProt 1–653

Lamassu C

Vibrio cholerae

UniProt A0A655W4S5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	DUF3732 domain-containing protein × 2 （A0A060KSR0） ABC-three component systems C-terminal domain-containing protein × 1 （A0A060KT36）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A655W4S5_VIBCL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 3–172； UniProt 1–170

ABC-three component systems C-terminal domain-containing protein

Vibrio cholerae

UniProt A0A060KT36

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	DUF3732 domain-containing protein × 2 （A0A060KSR0） Lamassu C × 1 （A0A655W4S5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A060KT36_VIBCL
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–388； UniProt 1–388

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9uxl
Deposition date deposition_date	2025-05-14
Structure title title	type II Lamassu, LmuACB from Vibrio cholerae O1 El
Keywords keywords	endonuclease; Structural maintenance of chromosomes (SMC) proteins; DNA BINDING PROTEIN, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9uxl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9uxl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9uxl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.07 Å
Rg (electron density)	49.47 Å
Total Rg	49.47 Å
Atom count	15005
Residues	1861
Excluded volume	267700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9uxl__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	DUF3732 domain-containing protein
Molecular weight formula_weight	74870.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,F
Atom count atom_count	15005

GSMFFQIEKVVLWSKEAKHKPRVIEFALNKVNLITGSSKSGKSSLIPIIDYCLGSSKCSIPVNTIRDTTAWYGVQIKTKHSRLLIARRDPSNQLSTSNAFFVEAENIEIPQNIEKHNVNIDTVKNRLNEISGVSNISFDFYDTGRIDKKRTSTRDLSAFNYQPQNIIANPNALFYKTDSFEHKSKLVTILPYVLGALSNTDIENQHRIKNLEEEYRKVERRLLKLKRQNEDWLSSAQAYVIKAMELGLVNSDKDIYQLKPERLLNVLKNIATKEIDYSTSAANIKYASEQEAEITKRSRDISNNLAKVKSRLQNINSMNRLANTHSDASRLKRERLSLSKWLLTQNDINSSLFSEPNEIRSLVLEPLARAFSNLEAELEVPIHVQGALSREKIYLEGELTRLASEMKDVNTQLKILRGNKRKLGYDAFSVGKFVGEVEKALSLMGESESESELSKEYKRLKKELSVLRLKIDPREFERKTKLQLAKVNKLASDWLPHLDTENPNAPISLHEKELTITVNSSGREDYLWEIGSGANWLSYHVAITLALHQHFSSLEASPVPNYIIYDQPSQVYFPSKLRHQATPEEDELALLEQDEDIVQVKKIFEAFNGAIEKTKDNLQIIVLDHAPSTLVKSIPKGHLVEEWRNGIKLIPLDWL

Source Source

Source organism organism	Vibrio cholerae
NCBI taxonomy ID ncbi_taxonomy_id	666
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Lamassu C
Molecular weight formula_weight	19483.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

GSMLKPENNLEKEAWEINNPAMCSYMLWIATLAYYQKQKEPIHPSRLFCLFPFILYSDTRNVLLSSKGSLKSYLAKFSNSKAISGDIPLSIHFRIDIQKNKTLDALIVAFDSGLLVIDSDSGLIKPNVSIKPLPNSKLTDTIKELVYCSTKIGRWLSEMTNQDLARDLKVIF

Source Source

Source organism organism	Vibrio cholerae
NCBI taxonomy ID ncbi_taxonomy_id	666
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	ABC-three component systems C-terminal domain-containing protein
Molecular weight formula_weight	44584.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MKDNSTSAVSSWLGYKIQEYRLTQRLLEANNSSCIGFEILDDLEEHTGSTSTFEQDKISTTGRNIVSNHSKDLWKTLSNWMDLIDSGEIDVDNTIFLLFTNKRCHSEVLQLLSTSQATEEASKAFDEILKIVSHPSPSIANYLNNFSKSKTDACRLISKFTYIYGSGSAPHDLRESYKLHRLGALEEHLDEIMYEILGWVSDVLTLAAEKRQPTIVRAKDFGARLGEIESKYRQKTILNYFCNRSSESEDVQNTIKDAPNYIKQLNLINVDDSELEEAAIANLETKDAVVEWTLNGDVQDYSYRYYQRELRRCWGIQKQKIHLDFNGRPETEVGQRLYIECLNNVTRYYLENKKVGDFFAHGTLHSMADKLTIGWHPEFDKKLGDPDA

Source Source

Source organism organism	Vibrio cholerae
NCBI taxonomy ID ncbi_taxonomy_id	666
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.070 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	4.07 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	78853

type II Lamassu, LmuACB from Vibrio cholerae O1 El

1. Protein Identity and Related Structures Protein Identity & Related Structures

DUF3732 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Lamassu C

State in the Current Structure

Other States of the Same Protein in the Database

ABC-three component systems C-terminal domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9uxl__assembly_1__model_1

9uxl__assembly_1__model_1 | I(q)

9uxl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)

type II Lamassu, LmuACB from Vibrio cholerae O1 El

1. Protein Identity and Related Structures Protein Identity & Related Structures

DUF3732 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Lamassu C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ABC-three component systems C-terminal domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9uxl__assembly_1__model_1

9uxl__assembly_1__model_1 | I(q)

9uxl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)