← Back to search

9v85

Superfolder GFP fused gp38 receptor binding domain of bacteriophage PP01

Method: X-RAY DIFFRACTION D_max: 123.9 Å Quality: REASONABLE

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9v85
deposition_date	2025-05-29
title	Superfolder GFP fused gp38 receptor binding domain of bacteriophage PP01
keywords	phage host recognition, phage tail fiber, receptor binding protein, CELL ADHESION; CELL ADHESION
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	36.82 Å
rg_electron	37.61 Å
i0	81621600.00
molecular_weight	69462.0 kDa
excluded_volume	85402 Å³
envelope_volume	112180 Å³
shell_volume	28050 Å³
envelope_diameter	127.7 Å
shell_rg	38.77 Å
envelope_rg	37.00 Å
shape_rg	37.58 Å
total_rg	37.77 Å
total_atoms	4905
n_residues	666
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	123.9 Å
rg_real	37.38 Å
rg_real_error	1.26 Å
i0_real	8.1620e+07
i0_real_error	1.3980e+06
rg_reciprocal	37.04 Å
i0_reciprocal	81590000.0000
total_estimate	0.7182
solution_quality	REASONABLE a REASONABLE solution
n_peaks	1
r_peak_primary	25.9 Å
skewness	0.483
kurtosis	-0.765
angular_range	— – 0.2150 Å⁻¹
current_alpha	0.0000
highest_alpha	5615000.0000
n_real_points	44
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.505; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.239; Smooth: 0.578

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Green fluorescent protein,Receptor-recognizing protein gp38
formula_weight	50520.7 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,C
atom_count	5496

SKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLXVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKESNSGRSVEVIHTLGADHNFNGQWFRDRCFEAGSAPIVFNITGDLVSYSRDVPLFFMYGDTPNEYVQLNIHGVTMYGRGGNGWAAGAIGASDGGVCIQNDIGGRLRINNGGAIAGGGGGGGGYSQANNWAGKYVCGGGGGRPFGLGGNNGARWPGGNASLTSPGAGGNTGTGYYAGGGGEVGQPGQYANPGAGYSTPPTNPGAAVAGSAPTWQNVGAIYGSRVSKLAAALEHHHHHH

Source

organism	Escherichia phage PP01
ncbi_taxonomy_id	2060720
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	CALCIUM ION
formula_weight	40.1 kDa
src_method	syn
entity_count	2

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	591

▶

6. Citations (1)

▶

length_a	172.217 Å
length_b	172.217 Å
length_c	79.710 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	16

space_group	P 43 21 2
int_tables_number	96
crystal_system	—

resolution	2.100 Å
resolution_low	37.880 Å
r_factor	0.1764
r_work	0.1754
r_free	0.2077

fit	/app/data/saxs_computation/v8/9v85/9v85.fit
pddf	/app/data/pr_computation/v8/9v85/9v85.pr.out
profile	/app/data/saxs_computation/v8/9v85/9v85.dat

Superfolder GFP fused gp38 receptor binding domain of bacteriophage PP01

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction