← Back to search

9wyr

Structural basis of signal activation and transduction by chitin elicitor receptor kinase 1 in Oryza sativa

Method: X-RAY DIFFRACTION D_max: 86.9 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9wyr
deposition_date	2025-09-27
title	Structural basis of signal activation and transduction by chitin elicitor receptor kinase 1 in Oryza sativa
keywords	OsCERK1-KD-K351R-ATP complex, the kinase domain mutant K351R of OsCERK1 bound to ATP in the normally purified state, TRANSFERASE; TRANSFERASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	28.07 Å
rg_electron	27.13 Å
i0	55956100.00
molecular_weight	59248.0 kDa
excluded_volume	74683 Å³
envelope_volume	94881 Å³
shell_volume	29037 Å³
envelope_diameter	84.5 Å
shell_rg	34.60 Å
envelope_rg	26.80 Å
shape_rg	27.15 Å
total_rg	27.92 Å
total_atoms	4169
n_residues	520
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	86.9 Å
rg_real	28.00 Å
rg_real_error	0.43 Å
i0_real	5.5960e+07
i0_real_error	7.9900e+05
rg_reciprocal	28.03 Å
i0_reciprocal	55960000.0000
total_estimate	0.9080
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	2
r_peak_primary	25.9 Å
skewness	0.154
kurtosis	-0.751
angular_range	— – 0.2850 Å⁻¹
current_alpha	0.0000
highest_alpha	25110000.0000
n_real_points	58
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.952; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.989; Smooth: 0.955

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Chitin elicitor receptor kinase 1
formula_weight	33506.2 kDa
ec_number	2.7.11.1
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	4303

GITVDKSVEFSYEELSNATQGFSIGNKIGQGGFGAVYYAELRGEKAAIRKMDMQATHEFLAELKVLTHVHHLNLVRLIGYCIESSLFLVYEFIENGNLSQHLRGMGYEPLSWAARIQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNYRAKVADFGLTKLTEVGGTSMPTGTRVVGTFGYMPPEYARYGDVSPKVDVYAFGVVLYELISAKEAIVRSTESSSDSKGLVYLFEEALNSPDPKEGLRTLIDPKLGEDYPIDSILKLTQLAKVCTQEDPKLRPSMRSVVVALMTLSSTSE

Source

organism	Oryza sativa Japonica Group
common_name	Japanese rice
ncbi_taxonomy_id	39947
host_organism	;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ;

Entity 2 non-polymer

description	ADENOSINE-5'-TRIPHOSPHATE
formula_weight	507.2 kDa
src_method	syn
entity_count	2

Entity 3 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	2

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	134

▶

6. Citations (1)

▶

length_a	108.757 Å
length_b	108.757 Å
length_c	121.457 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	120.00 °
z_pdb	12

space_group	P 31 2 1
int_tables_number	152
crystal_system	—

resolution	2.552 Å
resolution_low	74.429 Å
r_factor	0.2372
r_work	0.2345
r_free	0.2696

fit	/app/data/saxs_computation/wy/9wyr/9wyr.fit
pddf	/app/data/pr_computation/wy/9wyr/9wyr.pr.out
profile	/app/data/saxs_computation/wy/9wyr/9wyr.dat

Structural basis of signal activation and transduction by chitin elicitor receptor kinase 1 in Oryza sativa

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction