SAXSdb — 9x0x

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fimbrial assembly protein PilQ

Pseudomonas aeruginosa PAO1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Multidrug transporter × 14 （Q9I6D5） PHOSPHATIDYLETHANOLAMINE × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PILQ_PSEAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–714； UniProt 1–714 Author chain B； PDBConstruct 1–714； UniProt 1–714 Author chain C； PDBConstruct 1–714； UniProt 1–714 Author chain D； PDBConstruct 1–714； UniProt 1–714 Author chain E； PDBConstruct 1–714； UniProt 1–714 Author chain F； PDBConstruct 1–714； UniProt 1–714 Author chain G； PDBConstruct 1–714； UniProt 1–714 Author chain H； PDBConstruct 1–714； UniProt 1–714 Author chain I； PDBConstruct 1–714； UniProt 1–714 Author chain J； PDBConstruct 1–714； UniProt 1–714 Author chain K； PDBConstruct 1–714； UniProt 1–714 Author chain L； PDBConstruct 1–714； UniProt 1–714 Author chain M； PDBConstruct 1–714； UniProt 1–714 Author chain N； PDBConstruct 1–714； UniProt 1–714

Multidrug transporter

Pseudomonas aeruginosa PAO1

UniProt Q9I6D5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Fimbrial assembly protein PilQ × 14 （P34750） PHOSPHATIDYLETHANOLAMINE × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9I6D5_PSEAE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain O； PDBConstruct 1–114； UniProt 1–114 Author chain P； PDBConstruct 1–114； UniProt 1–114 Author chain Q； PDBConstruct 1–114； UniProt 1–114 Author chain R； PDBConstruct 1–114； UniProt 1–114 Author chain S； PDBConstruct 1–114； UniProt 1–114 Author chain T； PDBConstruct 1–114； UniProt 1–114 Author chain U； PDBConstruct 1–114； UniProt 1–114 Author chain V； PDBConstruct 1–114； UniProt 1–114 Author chain W； PDBConstruct 1–114； UniProt 1–114 Author chain X； PDBConstruct 1–114； UniProt 1–114 Author chain Y； PDBConstruct 1–114； UniProt 1–114 Author chain Z； PDBConstruct 1–114； UniProt 1–114 Author chain a； PDBConstruct 1–114； UniProt 1–114 Author chain b； PDBConstruct 1–114； UniProt 1–114

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9x0x
Deposition date deposition_date	2025-09-30
Structure title title	Pseudomonas aeruginosa (PAO1) Outer membrane PilQ (Secretin) with SlkB in C14 symmetry
Keywords keywords	type IV pili, secretin, plug, outer membrane, permeability barrier, antibiotics, drug resistance, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9x0x__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9x0x__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9x0x__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	63.03 Å
Rg (electron density)	62.50 Å
Total Rg	62.68 Å
Atom count	41454
Residues	5390
Excluded volume	746510 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9x0x__assembly_1__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Fimbrial assembly protein PilQ
Molecular weight formula_weight	77463.7 kDa
Source method src_method	man
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N
Atom count atom_count	41454

MNSGLSRLGIALLAAMFAPALLAADLEKLDVAALPGDRVELKLQFDEPVAAPRGYTIEQPARIALDLPGVQNKLGTKNRELSVGNTRSVTVVEAKDRTRLIINLTALSSYTTRVEGNNLFVVVGNSPAGASVASAAPVKASPAPASYAQPIKPKPYVPAGRAIRNIDFQRGEKGEGNVVIDLSDPTLSPDIQEQGGKIRLDFAKTQLPDALRVRLDVKDFATPVQFVNASAQSDRTSITIEPSGLYDYLVYQTDNRLTVSIKPMTTEDAERRKKDNFAYTGEKLSLNFQDIDVRSVLQLIADFTDLNLVASDTVQGNITLRLQNVPWDQALDLVLKTKGLDKRKLGNVLLVAPADEIAARERQELEAQKQIAELAPLRRELIQVNYAKAADIAKLFQSVTSDGGQEGKEGGRGSITVDDRTNSIIAYQPQERLDELRRIVSQLDIPVRQVMIEARIVEANVGYDKSLGVRWGGAYHKGNWSGYGKDGNIGIKDEDGMNCGPIAGSCTFPTTGTSKSPSPFVDLGAKDATSGIGIGFITDNIILDLQLSAMEKTGNGEIVSQPKVVTSDKETAKILKGSEVPYQEASSSGATSTSFKEAALSLEVTPQITPDNRIIVEVKVTKDAPDYQNMLNGVPPINKNEVNAKILVNDGETIVIGGVFSNEQSKSVEKVPFLGELPYLGRLFRRDTVTDRKNELLVFLTPRIMNNQAIAIGR

Source Source

Source organism organism	Pseudomonas aeruginosa PAO1
NCBI taxonomy ID ncbi_taxonomy_id	208964
Host organism host_organism	Pseudomonas aeruginosa PAO1

Entity 2 Entity 2 polymer

Description description	Multidrug transporter
Molecular weight formula_weight	11599.3 kDa
Source method src_method	man
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,S,P,Q,R,T,U,V,W,X,Y,Z,a,b

MNLFRTTALVLALTTGLSSMPALADAVQENASGDPMYTVEAPPAYAMIGDLLIARPFLIAATAVGAVAFVVSLPFTAASGSVGKAGQALVVDPGKEAFVRCLGCTTSGYNHDES

Source Source

Source organism organism	Pseudomonas aeruginosa PAO1
NCBI taxonomy ID ncbi_taxonomy_id	208964
Host organism host_organism	Pseudomonas aeruginosa PAO1

Entity 3 Entity 3 non-polymer

Description description	PHOSPHATIDYLETHANOLAMINE
Molecular weight formula_weight	734.0 kDa
Source method src_method	syn
Copy count entity_count	14

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.45 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	111983

Pseudomonas aeruginosa (PAO1) Outer membrane PilQ (Secretin) with SlkB in C14 symmetry

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fimbrial assembly protein PilQ

State in the Current Structure

Other States of the Same Protein in the Database

Multidrug transporter

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9x0x__assembly_1__model_1

9x0x__assembly_1__model_1 | I(q)

9x0x__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)

Pseudomonas aeruginosa (PAO1) Outer membrane PilQ (Secretin) with SlkB in C14 symmetry

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fimbrial assembly protein PilQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Multidrug transporter

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9x0x__assembly_1__model_1

9x0x__assembly_1__model_1 | I(q)

9x0x__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)