9x6r

Crystal structure of Frog M-ferritin E130A_K168E_H169D mutant

Method: X-RAY DIFFRACTION D_max: 66.5 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ferritin, middle subunit

Aquarana catesbeiana

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 24 PDB declaration: 24-meric（24） Consistent with protein copy count	Chain A； UniProt 2–175	Mutation：E130A,K168E,H169D	MG MAGNESIUM ION × 120 CL CHLORIDE ION × 240	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；2.0 M MgCl2 and 100 mM Bicine (pH 9.0)	Resolution 1.48 Å R-free 0.173

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9X6R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1MFR CRYSTAL STRUCTURE OF M FERRITIN Deposited 1998-06-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa） Chain B 1–176（176 aa） Chain C 1–176（176 aa） Chain D 1–176（176 aa） Chain E 1–176（176 aa） Chain F 1–176（176 aa） Chain G 1–176（176 aa） Chain H 1–176（176 aa） Chain I 1–176（176 aa） Chain J 1–176（176 aa） Chain K 1–176（176 aa） Chain L 1–176（176 aa） Chain M 1–176（176 aa） Chain N 1–176（176 aa） Chain O 1–176（176 aa） Chain P 1–176（176 aa） Chain Q 1–176（176 aa） Chain R 1–176（176 aa） Chain S 1–176（176 aa） Chain T 1–176（176 aa） Chain U 1–176（176 aa） Chain V 1–176（176 aa） Chain W 1–176（176 aa） Chain X 1–176（176 aa）	Not recorded	MG MAGNESIUM ION × 48	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.5；pH 4.5	Resolution 2.80 Å R-free 0.194
3KA3 Frog M-ferritin with magnesium Deposited 2009-10-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Not recorded	MG MAGNESIUM ION × 240 CL CHLORIDE ION × 168	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；277 K；2M MgCl2, 0.1M Bicine pH 9.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.40 Å R-free 0.159
3KA4 Frog M-ferritin with cobalt Deposited 2009-10-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Not recorded	CO COBALT (II) ION × 192 CL CHLORIDE ION × 192 MG MAGNESIUM ION × 144	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；277 K；2M MgCl2, 0.1M Bicine pH 9.0, 0.1M CoCl2, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.40 Å R-free 0.174
3KA6 Frog M-ferritin, EED mutant, with cobalt Deposited 2009-10-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Not recorded	CO COBALT (II) ION × 240 MG MAGNESIUM ION × 120 CL CHLORIDE ION × 96	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；277 K；2M MgCl2, 0.1M Bicine pH 9.0, 0.1M CoCl2, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.40 Å R-free 0.166
3KA8 Frog M-ferritin, EQH mutant, with cobalt Deposited 2009-10-19	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Not recorded	CO COBALT (II) ION × 120 MG MAGNESIUM ION × 144 CL CHLORIDE ION × 168	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；277 K；2M MgCl2, 0.1M Bicine pH 9.0, 0.1M CoCl2, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.35 Å R-free 0.153
3KA9 Frog M-ferritin, EEH mutant, with cobalt Deposited 2009-10-19	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Not recorded	CO COBALT (II) ION × 168 MG MAGNESIUM ION × 120 CL CHLORIDE ION × 120	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；277 K；2M MgCl2, 0.1M Bicine pH 9.0, 0.1M CoCl2, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.45 Å R-free 0.165
3RBC Bullfrog M ferritin with iron(III) bound to the ferroxidase site Deposited 2011-03-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa） Chain B 1–176（176 aa） Chain C 1–176（176 aa） Chain D 1–176（176 aa） Chain E 1–176（176 aa） Chain F 1–176（176 aa） Chain G 1–176（176 aa） Chain H 1–176（176 aa） Chain I 1–176（176 aa） Chain J 1–176（176 aa） Chain K 1–176（176 aa） Chain L 1–176（176 aa） Chain M 1–176（176 aa） Chain N 1–176（176 aa） Chain O 1–176（176 aa） Chain P 1–176（176 aa） Chain Q 1–176（176 aa） Chain R 1–176（176 aa） Chain S 1–176（176 aa） Chain T 1–176（176 aa） Chain U 1–176（176 aa） Chain V 1–176（176 aa） Chain W 1–176（176 aa） Chain X 1–176（176 aa）	Not recorded	FE FE (III) ION × 50	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；3M sodium formate, 8% v/v ethylene glycol,20 mM TRIS.HCl, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.70 Å R-free 0.235
3RE7 Copper (II) loaded Bullfrog Ferritin M chain Deposited 2011-04-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa） Chain B 1–176（176 aa） Chain C 1–176（176 aa） Chain D 1–176（176 aa） Chain E 1–176（176 aa） Chain F 1–176（176 aa） Chain G 1–176（176 aa） Chain H 1–176（176 aa） Chain I 1–176（176 aa） Chain J 1–176（176 aa） Chain K 1–176（176 aa） Chain L 1–176（176 aa） Chain M 1–176（176 aa） Chain N 1–176（176 aa） Chain O 1–176（176 aa） Chain P 1–176（176 aa） Chain Q 1–176（176 aa） Chain R 1–176（176 aa） Chain S 1–176（176 aa） Chain T 1–176（176 aa） Chain U 1–176（176 aa） Chain V 1–176（176 aa） Chain W 1–176（176 aa） Chain X 1–176（176 aa）	Not recorded	CU COPPER (II) ION × 162	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；7 mg/mL apo-ferritin solution in TrisHCl at pH 7.5 with 2.5M Na formate, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.82 Å R-free 0.224
3RGD Iron loaded frog M ferritin. Short soaking time Deposited 2011-04-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa） Chain B 1–176（176 aa） Chain C 1–176（176 aa） Chain D 1–176（176 aa） Chain E 1–176（176 aa） Chain F 1–176（176 aa） Chain G 1–176（176 aa） Chain H 1–176（176 aa） Chain I 1–176（176 aa） Chain J 1–176（176 aa） Chain K 1–176（176 aa） Chain L 1–176（176 aa） Chain M 1–176（176 aa） Chain N 1–176（176 aa） Chain O 1–176（176 aa） Chain P 1–176（176 aa） Chain Q 1–176（176 aa） Chain R 1–176（176 aa） Chain S 1–176（176 aa） Chain T 1–176（176 aa） Chain U 1–176（176 aa） Chain V 1–176（176 aa） Chain W 1–176（176 aa） Chain X 1–176（176 aa）	Not recorded	FE FE (III) ION × 62	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；7 mg/mL frog M ferritin solution at pH 7.5 with TrisHCl. Precipitant: 2.1M sodium formate, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.89 Å R-free 0.229
3SE1 Frog M-ferritin with magnesium, R72D mutant Deposited 2011-06-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：R72D	MG MAGNESIUM ION × 216 CL CHLORIDE ION × 216	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；2.0 M MgCl2, 100 mM BICINE, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.65 Å R-free 0.203
3SH6 Frog M-ferritin, D122R mutant, with magnesium Deposited 2011-06-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：D122R	MG MAGNESIUM ION × 168 CL CHLORIDE ION × 72	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 9；277 K；2M MGCL2, 0.1M BICINE, pH 9.0, EVAPORATION, temperature 277K	Resolution 1.40 Å R-free 0.192
3SHX Frog M-ferritin with magnesium, L134P mutant Deposited 2011-06-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：L134P	MG MAGNESIUM ION × 240 CL CHLORIDE ION × 168 NA SODIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；2M MGCL2, 0.1M BICINE, pH 9, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.35 Å R-free 0.163
4DAS Crystal structure of Bullfrog M ferritin Deposited 2012-01-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa） Chain B 1–176（176 aa） Chain C 1–176（176 aa） Chain D 1–176（176 aa） Chain E 1–176（176 aa） Chain F 1–176（176 aa） Chain G 1–176（176 aa） Chain H 1–176（176 aa） Chain I 1–176（176 aa） Chain J 1–176（176 aa） Chain K 1–176（176 aa） Chain L 1–176（176 aa） Chain M 1–176（176 aa） Chain N 1–176（176 aa） Chain O 1–176（176 aa） Chain P 1–176（176 aa） Chain Q 1–176（176 aa） Chain R 1–176（176 aa） Chain S 1–176（176 aa） Chain T 1–176（176 aa） Chain U 1–176（176 aa） Chain V 1–176（176 aa） Chain W 1–176（176 aa） Chain X 1–176（176 aa）	Not recorded	PGE TRIETHYLENE GLYCOL × 22 EDO 1,2-ETHANEDIOL × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；3.0 M sodium formate, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 2.56 Å R-free 0.239
4LPJ One minute iron loaded frog M ferritin Deposited 2013-07-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Not recorded	FE2 FE (II) ION × 24 MG MAGNESIUM ION × 312 CL CHLORIDE ION × 312	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；298 K；1.6-2M magnesium chloride, 0.1M bicine, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.27 Å R-free 0.175
4LPM Frog M-ferritin with magnesium, D127E mutant Deposited 2013-07-16	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 2–175（174 aa）	Mutation：D127E	CL CHLORIDE ION × 144 MG MAGNESIUM ION × 264	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；2M MgCl2, 0.1M Bicine, VAPOR DIFFUSION, HANGING DROP, temperature 277K, pH 9	Resolution 1.65 Å R-free 0.164
4LPN Frog M-ferritin with cobalt, D127E mutant Deposited 2013-07-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：D127E	CO COBALT (II) ION × 264 CL CHLORIDE ION × 216 MG MAGNESIUM ION × 72	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；2M MgCl2, 0.1M Bicine, 0.1M CoCl2, pH 9, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.66 Å R-free 0.177
4LQH High resolution structure of native frog M ferritin Deposited 2013-07-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Not recorded	MG MAGNESIUM ION × 216 CL CHLORIDE ION × 384	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；298 K；1.6-2M magnesium chloride, 0.1M bicine , pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.16 Å R-free 0.160
4LQJ Two minutes iron loaded frog M ferritin Deposited 2013-07-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Not recorded	FE2 FE (II) ION × 72 MG MAGNESIUM ION × 240 CL CHLORIDE ION × 288	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；1.6-2M magnesium chloride, 0.1M bicine , pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.20 Å R-free 0.145
4LQV Thrirty minutes iron loaded frog M ferritin Deposited 2013-07-19	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Not recorded	FE2 FE (II) ION × 72 MG MAGNESIUM ION × 144 CL CHLORIDE ION × 120	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；1.6-2M magnesium chloride, 0.1M bicine , pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.54 Å R-free 0.193
4LYU Fifteen minutes iron loaded frog M ferritin Deposited 2013-07-31	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Not recorded	FE2 FE (II) ION × 144 MG MAGNESIUM ION × 168 CL CHLORIDE ION × 216	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；1.6-2M magnesium chloride, 0.1M bicine, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.75 Å R-free 0.204
4LYX five minutes iron loaded frog M ferritin Deposited 2013-07-31	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Not recorded	FE2 FE (II) ION × 72 MG MAGNESIUM ION × 264 CL CHLORIDE ION × 288	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；1.6-2M magnesium chloride, 0.1M bicine , pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.23 Å R-free 0.175
4MJY Sixty minutes iron loaded frog M ferritin mutant H54Q Deposited 2013-09-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：H54Q	FE2 FE (II) ION × 192 MG MAGNESIUM ION × 72 CL CHLORIDE ION × 120	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；1.6-2M magnesium chloride, 0.1M bicine, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.40 Å R-free 0.185
4MKU Frog M ferritin mutant H54Q Deposited 2013-09-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：H54Q	MG MAGNESIUM ION × 264 CL CHLORIDE ION × 312	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；1.6-2M magnesium chloride, 0.1M bicine, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.30 Å R-free 0.139
4ML5 one minute iron loaded frog M ferritin mutant H54Q Deposited 2013-09-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：H54Q	FE2 FE (II) ION × 96 MG MAGNESIUM ION × 216 CL CHLORIDE ION × 384	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；1.6-2M magnesium chloride, 0.1M bicine, pH 9, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.22 Å R-free 0.154
4MN9 Fifteen minutes iron loaded frog M ferritin mutant H54Q Deposited 2013-09-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：H54Q	FE FE (III) ION × 144 MG MAGNESIUM ION × 192 CL CHLORIDE ION × 240	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；277 K；1.6-2M magnesium chloride, 0.1M bicine, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.15 Å R-free 0.153
4MY7 frog M ferritin iron-loaded under anaerobic environment Deposited 2013-09-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Not recorded	FE2 FE (II) ION × 120 MG MAGNESIUM ION × 192 CL CHLORIDE ION × 144	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；1.6-2M magnesium chloride, 0.1M bicine, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.48 Å R-free 0.195
4P18 Crystal Structure of frog M ferritin mutant D80K Deposited 2014-02-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa） Chain B 1–176（176 aa） Chain C 1–176（176 aa） Chain D 1–176（176 aa） Chain E 1–176（176 aa） Chain F 1–176（176 aa） Chain G 1–176（176 aa） Chain H 1–176（176 aa） Chain I 1–176（176 aa） Chain J 1–176（176 aa） Chain K 1–176（176 aa） Chain L 1–176（176 aa） Chain M 1–176（176 aa） Chain N 1–176（176 aa） Chain O 1–176（176 aa） Chain P 1–176（176 aa） Chain Q 1–176（176 aa） Chain R 1–176（176 aa） Chain S 1–176（176 aa） Chain T 1–176（176 aa） Chain U 1–176（176 aa） Chain V 1–176（176 aa） Chain W 1–176（176 aa） Chain X 1–176（176 aa）	Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K Mutation：D80K	SO4 SULFATE ION × 25 EDO 1,2-ETHANEDIOL × 51 ACT ACETATE ION × 2 CL CHLORIDE ION × 31	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；277 K；1.0 M Ammonium sulfate, 0.1 M Sodium acetate pH 4.6	Resolution 1.91 Å R-free 0.231
5J8S Iron-free state of Rana Catesbeiana H' ferritin variant E57A/E136A/D140A Deposited 2016-04-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：E57A, E136A, D140A	MG MAGNESIUM ION × 192 CL CHLORIDE ION × 336	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；281 K；1.6-2.0 M MgCl2 and 0.1 M bicine pH 9.0	Resolution 1.50 Å R-free 0.179
5J8W One minute iron loaded Rana Catesbeiana H' ferritin variant E57A/E136A/D140A Deposited 2016-04-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：E57A, E136A, D140A	FE2 FE (II) ION × 24 CL CHLORIDE ION × 480 MG MAGNESIUM ION × 216	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；281 K；1.6-2.0 M MgCl2 and 0.1 M bicine pH 9.0	Resolution 1.11 Å R-free 0.141
5J93 Five minutes iron loaded Rana Catesbeiana H' ferritin variant E57A/E136A/D140A Deposited 2016-04-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：E57A, E136A, D140A	FE2 FE (II) ION × 72 CL CHLORIDE ION × 312 MG MAGNESIUM ION × 192	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；281 K；1.6-2.0 M MgCl2 and 0.1 M bicine pH 9.0	Resolution 1.10 Å R-free 0.143
5J9V Ten minutes iron loaded Rana Catesbeiana H' ferritin variant E57A/E136A/D140A Deposited 2016-04-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：E57A, E136A, D140A	FE2 FE (II) ION × 168 MG MAGNESIUM ION × 144 CL CHLORIDE ION × 408	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；281 K；1.6-2.0 M MgCl2 and 0.1 M bicine pH 9.0	Resolution 1.16 Å R-free 0.138
5JAC Sixty minutes iron loaded Rana Catesbeiana H' ferritin variant E57A/E136A/D140A Deposited 2016-04-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：E57A, E136A, D140A	FE2 FE (II) ION × 72 CL CHLORIDE ION × 336 MG MAGNESIUM ION × 216	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；281 K；1.6-2.0 M MgCl2 and 0.1 M bicine pH 9.0	Resolution 1.18 Å R-free 0.134
5XHI Crystal structure of Frog M-ferritin D38A mutant Deposited 2017-04-21	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 2–175（174 aa）	Mutation：D38A	MG MAGNESIUM ION × 264 CL CHLORIDE ION × 648	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；2.0 M MgCl2 and 100 mM Bicine (pH 9.0)	Resolution 1.26 Å R-free 0.153
5XHM Crystal structure of Frog M-ferritin D40A mutant Deposited 2017-04-21	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 2–175（174 aa）	Mutation：D40A	MG MAGNESIUM ION × 240 CL CHLORIDE ION × 192	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；2.0 M MgCl2 and 100 mM Bicine (pH 9.0)	Resolution 1.70 Å R-free 0.187
5XHN Crystal structure of Frog M-ferritin K104E mutant Deposited 2017-04-21	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 2–175（174 aa）	Mutation：K104E	MG MAGNESIUM ION × 288 CL CHLORIDE ION × 264	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；2.0 M MgCl2 and 100 mM Bicine (pH 9.0)	Resolution 1.63 Å R-free 0.192
5XHO Crystal structure of Frog M-ferritin E135K mutant Deposited 2017-04-21	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 2–175（174 aa）	Mutation：E135K	MG MAGNESIUM ION × 288 CL CHLORIDE ION × 264	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；2.0 M MgCl2 and 100 mM Bicine (pH 9.0)	Resolution 1.73 Å R-free 0.183
6I36 SIXTY MINUTES IRON LOADED FROG M FERRITIN Deposited 2018-11-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Not recorded	FE2 FE (II) ION × 144 MG MAGNESIUM ION × 96 CL CHLORIDE ION × 360	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；1.6-2M MAGNESIUM CHLORIDE, 0.1M BICINE, pH 9.0, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 277K	Resolution 1.59 Å R-free 0.205
6I9P Iron-free state of Rana catesbeiana H' ferritin variant H54N Deposited 2018-11-24	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：H54N	MG MAGNESIUM ION × 288 CL CHLORIDE ION × 264	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；281 K；1.6-2.0 M MgCl2 and 0.1 M bicine pH 9.0	Resolution 1.25 Å R-free 0.133
6I9T Two minutes iron loaded Rana Catesbeiana H' ferritin variant H54N Deposited 2018-11-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：H54N	FE2 FE (II) ION × 24 MG MAGNESIUM ION × 288 CL CHLORIDE ION × 216	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；281 K；1.6-2.0 M MgCl2 and 0.1 M bicine pH 9.0	Resolution 1.20 Å R-free 0.137
6IAF Fifteen minutes iron loaded Rana Catesbeiana H' ferritin variant H54N Deposited 2018-11-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：H54N	FE2 FE (II) ION × 144 MG MAGNESIUM ION × 168 CL CHLORIDE ION × 216	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；281 K；1.6-2.0 M MgCl2 and 0.1 M bicine pH 9.0	Resolution 1.35 Å R-free 0.141
6IAJ Sixty minutes iron loaded Rana Catesbeiana H' ferritin variant H54N Deposited 2018-11-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–176（176 aa）	Mutation：H54N	FE2 FE (II) ION × 144 MG MAGNESIUM ION × 144 CL CHLORIDE ION × 168	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；281 K；1.6-2.0 M MgCl2 and 0.1 M bicine pH 9.0	Resolution 1.62 Å R-free 0.184
9WX5 Crystal structure of frog M-ferritin E130A_M161E mutant Deposited 2025-09-24	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 2–175（174 aa）	Not recorded	MG MAGNESIUM ION × 216 CL CHLORIDE ION × 264	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；2.0 M MgCl2 and 100 mM Bicine (pH 9.0)	Resolution 1.50 Å R-free 0.163
9WY3 Crystal structure of Frog M-ferritin E130A_L165D mutant Deposited 2025-09-26	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–175（175 aa）	Not recorded	MG MAGNESIUM ION × 168 CL CHLORIDE ION × 168	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；2.0 M MgCl2 and 100 mM Bicine (pH 9.0)	Resolution 1.77 Å R-free 0.188
9X0V Crystal structure of Frog M-ferritin E130A_M161E_L165D mutant Deposited 2025-09-30	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–175（175 aa）	Mutation：E130QA,M161E,L165D	MG MAGNESIUM ION × 240 CL CHLORIDE ION × 192	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；2.0 M MgCl2 and 100 mM Bicine (pH 9.0)	Resolution 1.80 Å R-free 0.184
9X15 Crystal structure of Frog M-ferritin E130A_L165D_K168E_H169D mutants Deposited 2025-10-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–175（175 aa）	Mutation：E130A,L165D,K168E,H169D	MG MAGNESIUM ION × 216 CL CHLORIDE ION × 432	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；2.0 M MgCl2 and 100 mM Bicine (pH 9.0)	Resolution 1.45 Å R-free 0.151
9X16 Crystal structure of Frog M-ferritin E130A_M161Q_L165D_K168E_H169D mutant Deposited 2025-10-01	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 2–175（174 aa）	Mutation：E130A,M161Q,L165D,K168E,H169D	MG MAGNESIUM ION × 168 CL CHLORIDE ION × 384	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；2.0 M MgCl2 and 100 mM Bicine (pH 9.0)	Resolution 1.55 Å R-free 0.153
9X1G Crystal structure of Frog M-ferritin WT_M161Q_L165D_K168E_H169D mutant Deposited 2025-10-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 2–174（173 aa）	Mutation：M161Q,L165D,K168E,H169D	MG MAGNESIUM ION × 216 CL CHLORIDE ION × 288	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；2.0 M MgCl2 and 100 mM Bicine (pH 9.0)	Resolution 1.50 Å R-free 0.154

47 other PDB entries and 47 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FRI2_AQUCT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–174； UniProt 2–175

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9x6r
Deposition date deposition_date	2025-10-15
最后修订 last_revision	2026-04-15
Structure title title	Crystal structure of Frog M-ferritin E130A_K168E_H169D mutant
Keywords keywords	Metal binding protein, Metal transport and storage protein, METAL TRANSPORT; METAL TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	19.20 Å
Radius of gyration Rg (electron density) rg_electron	18.32 Å
Forward intensity I(0) i0	8488360.00
Molecular weight molecular_weight	20398.0 kDa
Excluded volume excluded_volume	25011 Å³
Envelope volume envelope_volume	29404 Å³
Hydration-shell volume shell_volume	14404 Å³
Envelope diameter envelope_diameter	68.5 Å
Shell Rg shell_rg	23.25 Å
Envelope Rg envelope_rg	18.82 Å
Shape Rg shape_rg	18.24 Å
Total Rg total_rg	19.32 Å
Total atoms total_atoms	1418
Residues n_residues	171
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	66.5 Å
Rg (real space) rg_real	19.35 Å
Rg uncertainty (real space) rg_real_error	0.57 Å
I(0) (real space) i0_real	8.4880e+06
I(0) uncertainty (real space) i0_real_error	1.0420e+05
Rg (reciprocal space) rg_reciprocal	19.33 Å
I(0) (reciprocal space) i0_reciprocal	8488000.0000
Solution quality estimate total_estimate	0.7549
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	18.5 Å
Skewness Skewness skewness	0.540
Kurtosis Kurtosis kurtosis	-0.192
Angular range angular_range	— – 0.4150 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1872000.0000
Real-space data points n_real_points	73
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.670; Stabil: 0.997; Sysdev: 1.000; Positv: 1.000; Valcen: 0.808; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Ferritin, middle subunit
Molecular weight formula_weight	20323.7 kDa
EC 编号 ec_number	1.16.3.1
Mutation mutation	E130A,K168E,H169D
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1642

VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQDIKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDKVDPHLCDFLASEYLEEQVKDIKRIGDFITNLKRLGLPENGMGEYLFDEDSVKES

来源 Source

来源生物 organism	Aquarana catesbeiana
通用名 common_name	American bullfrog
NCBI Class编号 ncbi_taxonomy_id	8400
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	190

▶

8. Citations (1)

▶

Unit-cell length a length_a	183.901 Å
Unit-cell length b length_b	183.901 Å
Unit-cell length c length_c	183.901 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	96

Space group space_group	F 4 3 2
Space-group number int_tables_number	209
Crystal system crystal_system	—

Resolution resolution	1.480 Å
Low-resolution limit resolution_low	37.570 Å
R factor r_factor	—
R_work r_work	0.1454
R_free r_free	0.1728

fit	/app/data/saxs_computation/x6/9x6r/9x6r.fit
pddf	/app/data/pr_computation/x6/9x6r/9x6r.pr.out
profile	/app/data/saxs_computation/x6/9x6r/9x6r.dat