← Back to search

9x6r

Crystal structure of Frog M-ferritin E130A_K168E_H169D mutant

Method: X-RAY DIFFRACTION D_max: 66.5 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9x6r
deposition_date	2025-10-15
last_revision	2026-04-15
title	Crystal structure of Frog M-ferritin E130A_K168E_H169D mutant
keywords	Metal binding protein, Metal transport and storage protein, METAL TRANSPORT; METAL TRANSPORT
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	19.20 Å
rg_electron	18.32 Å
i0	8488360.00
molecular_weight	20398.0 kDa
excluded_volume	25011 Å³
envelope_volume	29404 Å³
shell_volume	14404 Å³
envelope_diameter	68.5 Å
shell_rg	23.25 Å
envelope_rg	18.82 Å
shape_rg	18.24 Å
total_rg	19.32 Å
total_atoms	1418
n_residues	171
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	66.5 Å
rg_real	19.35 Å
rg_real_error	0.57 Å
i0_real	8.4880e+06
i0_real_error	1.0420e+05
rg_reciprocal	19.33 Å
i0_reciprocal	8488000.0000
total_estimate	0.7549
solution_quality	GOOD a GOOD solution
n_peaks	3
r_peak_primary	18.5 Å
skewness	0.540
kurtosis	-0.192
angular_range	— – 0.4150 Å⁻¹
current_alpha	0.0000
highest_alpha	1872000.0000
n_real_points	73
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.670; Stabil: 0.997; Sysdev: 1.000; Positv: 1.000; Valcen: 0.808; Smooth: 0.000

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Ferritin, middle subunit
formula_weight	20323.7 kDa
ec_number	1.16.3.1
mutation	E130A,K168E,H169D
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	1642

VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQDIKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDKVDPHLCDFLASEYLEEQVKDIKRIGDFITNLKRLGLPENGMGEYLFDEDSVKES

Source

organism	Aquarana catesbeiana
common_name	American bullfrog
ncbi_taxonomy_id	8400
host_organism	Escherichia coli

Entity 2 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	5

Entity 3 non-polymer

description	CHLORIDE ION
formula_weight	35.5 kDa
src_method	syn
entity_count	10

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	190

▶

6. Citations (1)

▶

length_a	183.901 Å
length_b	183.901 Å
length_c	183.901 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	96

space_group	F 4 3 2
int_tables_number	209
crystal_system	—

resolution	1.480 Å
resolution_low	37.570 Å
r_factor	—
r_work	0.1454
r_free	0.1728

fit	/app/data/saxs_computation/x6/9x6r/9x6r.fit
pddf	/app/data/pr_computation/x6/9x6r/9x6r.pr.out
profile	/app/data/saxs_computation/x6/9x6r/9x6r.dat

Crystal structure of Frog M-ferritin E130A_K168E_H169D mutant

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction