SAXSdb — 9yee

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 49	Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （Q9KQ10）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KQ12_VIBCH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Ba； PDBConstruct 1–262； UniProt 1–262 Author chain Bb； PDBConstruct 1–262； UniProt 1–262 Author chain Bc； PDBConstruct 1–262； UniProt 1–262 Author chain Bd； PDBConstruct 1–262； UniProt 1–262 Author chain Be； PDBConstruct 1–262； UniProt 1–262 Author chain Bf； PDBConstruct 1–262； UniProt 1–262 Author chain Bg； PDBConstruct 1–262； UniProt 1–262 Author chain Bh； PDBConstruct 1–262； UniProt 1–262 Author chain Bi； PDBConstruct 1–262； UniProt 1–262 Author chain Bj； PDBConstruct 1–262； UniProt 1–262 Author chain Bk； PDBConstruct 1–262； UniProt 1–262 Author chain Bl； PDBConstruct 1–262； UniProt 1–262 Author chain Bm； PDBConstruct 1–262； UniProt 1–262 Author chain Bn； PDBConstruct 1–262； UniProt 1–262 Author chain Bo； PDBConstruct 1–262； UniProt 1–262 Author chain Bp； PDBConstruct 1–262； UniProt 1–262 Author chain Bq； PDBConstruct 1–262； UniProt 1–262 Author chain Br； PDBConstruct 1–262； UniProt 1–262 Author chain Bs； PDBConstruct 1–262； UniProt 1–262 Author chain Bt； PDBConstruct 1–262； UniProt 1–262 Author chain Bu； PDBConstruct 1–262； UniProt 1–262 Author chain Bv； PDBConstruct 1–262； UniProt 1–262 Author chain Bw； PDBConstruct 1–262； UniProt 1–262 Author chain Bx； PDBConstruct 1–262； UniProt 1–262 Author chain By； PDBConstruct 1–262； UniProt 1–262 Author chain Bz； PDBConstruct 1–262； UniProt 1–262 Author chain Cb； PDBConstruct 1–262； UniProt 1–262

Flagellar basal-body rod protein FlgF

OrganismNot specified

UniProt Q9KQ11

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 49	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar hook protein FlgE × 17 （Q9KQ10）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KQ11_VIBCH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain Ca； PDBConstruct 1–249； UniProt 1–249 Author chain Cc； PDBConstruct 1–249； UniProt 1–249 Author chain Cd； PDBConstruct 1–249； UniProt 1–249 Author chain Cv； PDBConstruct 1–249； UniProt 1–249 Author chain Cw； PDBConstruct 1–249； UniProt 1–249

Flagellar hook protein FlgE

OrganismNot specified

UniProt Q9KQ10

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 49	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KQ10_VIBCH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain Ce； PDBConstruct 1–434； UniProt 1–434 Author chain Cf； PDBConstruct 1–434； UniProt 1–434 Author chain Cg； PDBConstruct 1–434； UniProt 1–434 Author chain Ch； PDBConstruct 1–434； UniProt 1–434 Author chain Ci； PDBConstruct 1–434； UniProt 1–434 Author chain Cj； PDBConstruct 1–434； UniProt 1–434 Author chain Ck； PDBConstruct 1–434； UniProt 1–434 Author chain Cl； PDBConstruct 1–434； UniProt 1–434 Author chain Cm； PDBConstruct 1–434； UniProt 1–434 Author chain Cn； PDBConstruct 1–434； UniProt 1–434 Author chain Co； PDBConstruct 1–434； UniProt 1–434 Author chain Cp； PDBConstruct 1–434； UniProt 1–434 Author chain Cq； PDBConstruct 1–434； UniProt 1–434 Author chain Cr； PDBConstruct 1–434； UniProt 1–434 Author chain Cs； PDBConstruct 1–434； UniProt 1–434 Author chain Ct； PDBConstruct 1–434； UniProt 1–434 Author chain Cu； PDBConstruct 1–434； UniProt 1–434

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9yee
Deposition date deposition_date	2025-09-24
Structure title title	Rod-hook protein in Vibrio cholerae at assembled, opened state
Keywords keywords	In situ cryo-EM, sheathed flagellar motor, Vibrio cholerae, rod-hook, assembled state, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9yee__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9yee__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9yee__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	74.52 Å
Rg (electron density)	74.82 Å
Total Rg	74.78 Å
Atom count	96589
Residues	12773
Excluded volume	1700600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9yee__assembly_1__model_1`	49-meric （49）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Flagellar basal-body rod protein FlgG
Molecular weight formula_weight	28114.3 kDa
Source method src_method	nat
Copy count entity_count	27

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ba,Bb,Bc,Bd,Be,Bf,Bg,Bh,Bi,Bj,Bk,Bl,Bm,Bn,Bo,Bp,Bq,Br,Bs,Bt,Bu,Bv,Bw,Bx,By,Bz,Cb
Atom count atom_count	96589

MQPALWVSKTGLDAQQTNIATISNNLANASTIGFKKGRAVFEDLFYQNINQPGAQSSQNTRLPSGLMLGAGSKVVATQKVHTNGNVQTTSNSLDMMIEGDGFFQILMPDGNIAYSRNGQFTLDDEGAIVTSGAGYRLQPEIIIPEDAISITIGNDGEVSVRVRGQQDNQVLGQITTVDFINPGGLEPVGQNLYLPTGASGEPQEGVPGLDGLGDIRQSMLETSNVNVTEELVNMIEAQRVYEMNSKVISAVDKMMSFVNQQL

Entity 2 Entity 2 polymer

Description description	Flagellar basal-body rod protein FlgF
Molecular weight formula_weight	26778.3 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ca,Cc,Cd,Cv,Cw

MDRALFLAMSGAKQNMQAMQLRANNLANVSTTGFRADLAQARSMQAYGEGLPSRVFSMTERPGHNFAQGSVITTGRDLDITIQGDGWISVLDKTGKEGLTRNGNLRIDETGLLLNGNGHPVLGETGAPITLPVPLNKVEIGGDGTISVRPQGAPADAMEVVDRIKLVRLNDQSLFKDVNGLFRATDPNTQFEADASVKILTGALEGSNVNAIGEMTSLIDLQRQFEMQVKMMSTAEEMDKASDSLLRSS

Entity 3 Entity 3 polymer

Description description	Flagellar hook protein FlgE
Molecular weight formula_weight	46880.3 kDa
Source method src_method	nat
Copy count entity_count	17

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ce,Cf,Cg,Ch,Ci,Cj,Ck,Cl,Cm,Cn,Co,Cp,Cq,Cr,Cs,Ct,Cu

MSYVSLSGLSAAQMDLNTTSNNIANANTFGFKESRAEFGDVYSTSLFTNAKTTPGQGVQAAKVAQQFHEGSSIYTNNPLDLRIAGTGFFAVAKDRLVPQQNELTRNGAFHLDKNSFMVTANDEFLLGYEVNPDTGDVLSYEPKPINIPPQFGKPKQTANIDLGANLPANGDLKDPALFDITDPETYNRTTSSTIYDSMGQPYKLTTYYLKDMNQANTWQTYYTVTDKTGEKPINVVGGDAASPTGHVGHTMRFNNDGTLSSLNNGQPIVTEPLGGGANPVDLNGADVNQTLSFSLDSATQFAAPFELTKFDQDGATTGFLTKIDFDENGSVLATYSNGINTTLGRVALVRVANEQGLDKKGGTQWDATQFSGAKIWGESNKGSFGSISNGSLEQSNIDMTQELVDLISAQRNFQANSRALEVHNGLQQNILQIR

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.44 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	77446

Rod-hook protein in Vibrio cholerae at assembled, opened state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar basal-body rod protein FlgF

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar hook protein FlgE

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9yee__assembly_1__model_1

9yee__assembly_1__model_1 | I(q)

9yee__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)

Rod-hook protein in Vibrio cholerae at assembled, opened state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook protein FlgE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9yee__assembly_1__model_1

9yee__assembly_1__model_1 | I(q)

9yee__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)