9yh7

Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a higher FOMC conformation

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

Vibrio cholerae O1 biovar El Tor str. N16961

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 407	Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KQ12_VIBCH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–262； UniProt 1–262 Author chain Ab； PDBConstruct 1–262； UniProt 1–262 Author chain Ac； PDBConstruct 1–262； UniProt 1–262 Author chain Ad； PDBConstruct 1–262； UniProt 1–262 Author chain Ae； PDBConstruct 1–262； UniProt 1–262 Author chain Af； PDBConstruct 1–262； UniProt 1–262 Author chain Ag； PDBConstruct 1–262； UniProt 1–262 Author chain Ah； PDBConstruct 1–262； UniProt 1–262 Author chain Ai； PDBConstruct 1–262； UniProt 1–262 Author chain Aj； PDBConstruct 1–262； UniProt 1–262 Author chain Ak； PDBConstruct 1–262； UniProt 1–262 Author chain Al； PDBConstruct 1–262； UniProt 1–262 Author chain Am； PDBConstruct 1–262； UniProt 1–262 Author chain An； PDBConstruct 1–262； UniProt 1–262 Author chain Ao； PDBConstruct 1–262； UniProt 1–262 Author chain Ap； PDBConstruct 1–262； UniProt 1–262 Author chain Aq； PDBConstruct 1–262； UniProt 1–262 Author chain Ar； PDBConstruct 1–262； UniProt 1–262 Author chain As； PDBConstruct 1–262； UniProt 1–262 Author chain At； PDBConstruct 1–262； UniProt 1–262 Author chain Au； PDBConstruct 1–262； UniProt 1–262 Author chain Av； PDBConstruct 1–262； UniProt 1–262 Author chain Aw； PDBConstruct 1–262； UniProt 1–262 Author chain Ax； PDBConstruct 1–262； UniProt 1–262 Author chain Ay； PDBConstruct 1–262； UniProt 1–262 Author chain Az； PDBConstruct 1–262； UniProt 1–262 Author chain Bb； PDBConstruct 1–262； UniProt 1–262

Flagellar basal-body rod protein FlgF

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ11

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 407	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KQ11_VIBCH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain Ba； PDBConstruct 1–249； UniProt 1–249 Author chain Bc； PDBConstruct 1–249； UniProt 1–249 Author chain Bd； PDBConstruct 1–249； UniProt 1–249 Author chain Bv； PDBConstruct 1–249； UniProt 1–249 Author chain Bw； PDBConstruct 1–249； UniProt 1–249

Flagellar hook protein FlgE

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt A0A085QTL5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 407	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A085QTL5_VIBCL
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain Be； PDBConstruct 1–434； UniProt 1–434 Author chain Bf； PDBConstruct 1–434； UniProt 1–434 Author chain Bg； PDBConstruct 1–434； UniProt 1–434 Author chain Bh； PDBConstruct 1–434； UniProt 1–434 Author chain Bi； PDBConstruct 1–434； UniProt 1–434 Author chain Bj； PDBConstruct 1–434； UniProt 1–434 Author chain Bk； PDBConstruct 1–434； UniProt 1–434 Author chain Bl； PDBConstruct 1–434； UniProt 1–434 Author chain Bm； PDBConstruct 1–434； UniProt 1–434 Author chain Bn； PDBConstruct 1–434； UniProt 1–434 Author chain Bo； PDBConstruct 1–434； UniProt 1–434 Author chain Bp； PDBConstruct 1–434； UniProt 1–434 Author chain Bq； PDBConstruct 1–434； UniProt 1–434 Author chain Br； PDBConstruct 1–434； UniProt 1–434 Author chain Bs； PDBConstruct 1–434； UniProt 1–434 Author chain Bt； PDBConstruct 1–434； UniProt 1–434 Author chain Bu； PDBConstruct 1–434； UniProt 1–434

Flagellar L-ring protein

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ13

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 407	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGH_VIBCH
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Bx； PDBConstruct 1–227； UniProt 32–258 Author chain By； PDBConstruct 1–227； UniProt 32–258 Author chain Bz； PDBConstruct 1–227； UniProt 32–258 Author chain Ca； PDBConstruct 1–227； UniProt 32–258 Author chain Cb； PDBConstruct 1–227； UniProt 32–258 Author chain Cc； PDBConstruct 1–227； UniProt 32–258 Author chain Cd； PDBConstruct 1–227； UniProt 32–258 Author chain Ce； PDBConstruct 1–227； UniProt 32–258 Author chain Cf； PDBConstruct 1–227； UniProt 32–258 Author chain Cg； PDBConstruct 1–227； UniProt 32–258 Author chain Ch； PDBConstruct 1–227； UniProt 32–258 Author chain Ci； PDBConstruct 1–227； UniProt 32–258 Author chain Cj； PDBConstruct 1–227； UniProt 32–258 Author chain Ck； PDBConstruct 1–227； UniProt 32–258 Author chain Cl； PDBConstruct 1–227； UniProt 32–258 Author chain Cm； PDBConstruct 1–227； UniProt 32–258 Author chain Cn； PDBConstruct 1–227； UniProt 32–258 Author chain Co； PDBConstruct 1–227； UniProt 32–258 Author chain Cp； PDBConstruct 1–227； UniProt 32–258 Author chain Cq； PDBConstruct 1–227； UniProt 32–258 Author chain Cr； PDBConstruct 1–227； UniProt 32–258 Author chain Cs； PDBConstruct 1–227； UniProt 32–258 Author chain Ct； PDBConstruct 1–227； UniProt 32–258 Author chain Cu； PDBConstruct 1–227； UniProt 32–258 Author chain Cv； PDBConstruct 1–227； UniProt 32–258 Author chain Cw； PDBConstruct 1–227； UniProt 32–258

Flagellar P-ring protein

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ14

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 407	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGI_VIBCH
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain Cx； PDBConstruct 1–343； UniProt 19–361 Author chain Cy； PDBConstruct 1–343； UniProt 19–361 Author chain Cz； PDBConstruct 1–343； UniProt 19–361 Author chain Da； PDBConstruct 1–343； UniProt 19–361 Author chain Db； PDBConstruct 1–343； UniProt 19–361 Author chain Dc； PDBConstruct 1–343； UniProt 19–361 Author chain Dd； PDBConstruct 1–343； UniProt 19–361 Author chain De； PDBConstruct 1–343； UniProt 19–361 Author chain Df； PDBConstruct 1–343； UniProt 19–361 Author chain Dg； PDBConstruct 1–343； UniProt 19–361 Author chain Dh； PDBConstruct 1–343； UniProt 19–361 Author chain Di； PDBConstruct 1–343； UniProt 19–361 Author chain Dj； PDBConstruct 1–343； UniProt 19–361 Author chain Dk； PDBConstruct 1–343； UniProt 19–361 Author chain Dl； PDBConstruct 1–343； UniProt 19–361 Author chain Dm； PDBConstruct 1–343； UniProt 19–361 Author chain Dn； PDBConstruct 1–343； UniProt 19–361 Author chain Do； PDBConstruct 1–343； UniProt 19–361 Author chain Dp； PDBConstruct 1–343； UniProt 19–361 Author chain Dq； PDBConstruct 1–343； UniProt 19–361 Author chain Dr； PDBConstruct 1–343； UniProt 19–361 Author chain Ds； PDBConstruct 1–343； UniProt 19–361 Author chain Dt； PDBConstruct 1–343； UniProt 19–361 Author chain Du； PDBConstruct 1–343； UniProt 19–361 Author chain Dv； PDBConstruct 1–343； UniProt 19–361 Author chain Dw； PDBConstruct 1–343； UniProt 19–361

Flagellar protein FlgT

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KPZ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 407	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KPZ9_VIBCH
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain Dx； PDBConstruct 1–352； UniProt 26–377 Author chain Dy； PDBConstruct 1–352； UniProt 26–377 Author chain Dz； PDBConstruct 1–352； UniProt 26–377 Author chain Ea； PDBConstruct 1–352； UniProt 26–377 Author chain Eb； PDBConstruct 1–352； UniProt 26–377 Author chain Ec； PDBConstruct 1–352； UniProt 26–377 Author chain Ed； PDBConstruct 1–352； UniProt 26–377 Author chain Ee； PDBConstruct 1–352； UniProt 26–377 Author chain Ef； PDBConstruct 1–352； UniProt 26–377 Author chain Eg； PDBConstruct 1–352； UniProt 26–377 Author chain Eh； PDBConstruct 1–352； UniProt 26–377 Author chain Ei； PDBConstruct 1–352； UniProt 26–377 Author chain Ej； PDBConstruct 1–352； UniProt 26–377 Author chain Ek； PDBConstruct 1–352； UniProt 26–377 Author chain El； PDBConstruct 1–352； UniProt 26–377 Author chain Em； PDBConstruct 1–352； UniProt 26–377 Author chain En； PDBConstruct 1–352； UniProt 26–377 Author chain Eo； PDBConstruct 1–352； UniProt 26–377 Author chain Ep； PDBConstruct 1–352； UniProt 26–377 Author chain Eq； PDBConstruct 1–352； UniProt 26–377 Author chain Er； PDBConstruct 1–352； UniProt 26–377 Author chain Es； PDBConstruct 1–352； UniProt 26–377 Author chain Et； PDBConstruct 1–352； UniProt 26–377 Author chain Eu； PDBConstruct 1–352； UniProt 26–377 Author chain Ev； PDBConstruct 1–352； UniProt 26–377 Author chain Ew； PDBConstruct 1–352； UniProt 26–377

Sodium-type flagellar protein MotY

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KT95

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 407	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KT95_VIBCH
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Ex； PDBConstruct 1–271； UniProt 23–293 Author chain Ey； PDBConstruct 1–271； UniProt 23–293 Author chain Ez； PDBConstruct 1–271； UniProt 23–293 Author chain Fa； PDBConstruct 1–271； UniProt 23–293 Author chain Fb； PDBConstruct 1–271； UniProt 23–293 Author chain Fc； PDBConstruct 1–271； UniProt 23–293 Author chain Fd； PDBConstruct 1–271； UniProt 23–293 Author chain Fe； PDBConstruct 1–271； UniProt 23–293 Author chain Ff； PDBConstruct 1–271； UniProt 23–293 Author chain Fg； PDBConstruct 1–271； UniProt 23–293 Author chain Fh； PDBConstruct 1–271； UniProt 23–293 Author chain Fi； PDBConstruct 1–271； UniProt 23–293 Author chain Fj； PDBConstruct 1–271； UniProt 23–293 Author chain Fk； PDBConstruct 1–271； UniProt 23–293 Author chain Fl； PDBConstruct 1–271； UniProt 23–293 Author chain Fm； PDBConstruct 1–271； UniProt 23–293 Author chain Fn； PDBConstruct 1–271； UniProt 23–293 Author chain Fo； PDBConstruct 1–271； UniProt 23–293 Author chain Fp； PDBConstruct 1–271； UniProt 23–293 Author chain Fq； PDBConstruct 1–271； UniProt 23–293 Author chain Fr； PDBConstruct 1–271； UniProt 23–293 Author chain Fs； PDBConstruct 1–271； UniProt 23–293 Author chain Ft； PDBConstruct 1–271； UniProt 23–293 Author chain Fu； PDBConstruct 1–271； UniProt 23–293 Author chain Fv； PDBConstruct 1–271； UniProt 23–293 Author chain Fw； PDBConstruct 1–271； UniProt 23–293

Sodium-type flagellar protein MotX

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KNX9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 407	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KNX9_VIBCH
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Fx； PDBConstruct 1–183； UniProt 29–211 Author chain Fy； PDBConstruct 1–183； UniProt 29–211 Author chain Fz； PDBConstruct 1–183； UniProt 29–211 Author chain Ga； PDBConstruct 1–183； UniProt 29–211 Author chain Gb； PDBConstruct 1–183； UniProt 29–211 Author chain Gc； PDBConstruct 1–183； UniProt 29–211 Author chain Gd； PDBConstruct 1–183； UniProt 29–211 Author chain Ge； PDBConstruct 1–183； UniProt 29–211 Author chain Gf； PDBConstruct 1–183； UniProt 29–211 Author chain Gg； PDBConstruct 1–183； UniProt 29–211 Author chain Gh； PDBConstruct 1–183； UniProt 29–211 Author chain Gi； PDBConstruct 1–183； UniProt 29–211 Author chain Gj； PDBConstruct 1–183； UniProt 29–211 Author chain Gk； PDBConstruct 1–183； UniProt 29–211 Author chain Gl； PDBConstruct 1–183； UniProt 29–211 Author chain Gm； PDBConstruct 1–183； UniProt 29–211 Author chain Gn； PDBConstruct 1–183； UniProt 29–211 Author chain Go； PDBConstruct 1–183； UniProt 29–211 Author chain Gp； PDBConstruct 1–183； UniProt 29–211 Author chain Gq； PDBConstruct 1–183； UniProt 29–211 Author chain Gr； PDBConstruct 1–183； UniProt 29–211 Author chain Gs； PDBConstruct 1–183； UniProt 29–211 Author chain Gt； PDBConstruct 1–183； UniProt 29–211 Author chain Gu； PDBConstruct 1–183； UniProt 29–211 Author chain Gv； PDBConstruct 1–183； UniProt 29–211 Author chain Gw； PDBConstruct 1–183； UniProt 29–211

FlgP

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ01

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 407	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） Chemotaxis protein PomB × 26 （Q9KTK9） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KQ01_VIBCH
Isoform	—
PDB entities	9, 11
Chains and sequence ranges	Author chain Gx； PDBConstruct 1–12； UniProt 134–145 Author chain Gy； PDBConstruct 1–12； UniProt 134–145 Author chain Gz； PDBConstruct 1–12； UniProt 134–145 Author chain Ha； PDBConstruct 1–12； UniProt 134–145 Author chain Hb； PDBConstruct 1–12； UniProt 134–145 Author chain Hc； PDBConstruct 1–12； UniProt 134–145 Author chain Hd； PDBConstruct 1–12； UniProt 134–145 Author chain He； PDBConstruct 1–12； UniProt 134–145 Author chain Hf； PDBConstruct 1–12； UniProt 134–145 Author chain Hg； PDBConstruct 1–12； UniProt 134–145 Author chain Hh； PDBConstruct 1–12； UniProt 134–145 Author chain Hi； PDBConstruct 1–12； UniProt 134–145 Author chain Hj； PDBConstruct 1–12； UniProt 134–145 Author chain Hk； PDBConstruct 1–12； UniProt 134–145 Author chain Hl； PDBConstruct 1–12； UniProt 134–145 Author chain Hm； PDBConstruct 1–12； UniProt 134–145 Author chain Hn； PDBConstruct 1–12； UniProt 134–145 Author chain Ho； PDBConstruct 1–12； UniProt 134–145 Author chain Hp； PDBConstruct 1–12； UniProt 134–145 Author chain Hq； PDBConstruct 1–12； UniProt 134–145 Author chain Hr； PDBConstruct 1–12； UniProt 134–145 Author chain Hs； PDBConstruct 1–12； UniProt 134–145 Author chain Ht； PDBConstruct 1–12； UniProt 134–145 Author chain Hu； PDBConstruct 1–12； UniProt 134–145 Author chain Hv； PDBConstruct 1–12； UniProt 134–145 Author chain Hw； PDBConstruct 1–12； UniProt 134–145 Author chain Hx； PDBConstruct 1–12； UniProt 134–145 Author chain Hy； PDBConstruct 1–12； UniProt 134–145 Author chain Hz； PDBConstruct 1–12； UniProt 134–145 Author chain Ia； PDBConstruct 1–12； UniProt 134–145 Author chain Ib； PDBConstruct 1–12； UniProt 134–145 Author chain Ic； PDBConstruct 1–12； UniProt 134–145 Author chain Id； PDBConstruct 1–12； UniProt 134–145 Author chain Ie； PDBConstruct 1–12； UniProt 134–145 Author chain If； PDBConstruct 1–12； UniProt 134–145 Author chain Ig； PDBConstruct 1–12； UniProt 134–145 Author chain Ih； PDBConstruct 1–12； UniProt 134–145 Author chain Ii； PDBConstruct 1–12； UniProt 134–145 Author chain Ij； PDBConstruct 1–12； UniProt 134–145 Author chain Ik； PDBConstruct 1–12； UniProt 134–145 Author chain Il； PDBConstruct 1–12； UniProt 134–145 Author chain Im； PDBConstruct 1–12； UniProt 134–145 Author chain In； PDBConstruct 1–12； UniProt 134–145 Author chain Io； PDBConstruct 1–12； UniProt 134–145 Author chain Ip； PDBConstruct 1–12； UniProt 134–145 Author chain Iq； PDBConstruct 1–12； UniProt 134–145 Author chain Ir； PDBConstruct 1–12； UniProt 134–145 Author chain Is； PDBConstruct 1–12； UniProt 134–145 Author chain It； PDBConstruct 1–12； UniProt 134–145 Author chain Iu； PDBConstruct 1–12； UniProt 134–145 Author chain Iv； PDBConstruct 1–12； UniProt 134–145 Author chain Iw； PDBConstruct 1–12； UniProt 134–145 Author chain Jx； PDBConstruct 1–104； UniProt 26–130 Author chain Jy； PDBConstruct 1–104； UniProt 26–130 Author chain Jz； PDBConstruct 1–104； UniProt 26–130 Author chain Ka； PDBConstruct 1–104； UniProt 26–130 Author chain Kb； PDBConstruct 1–104； UniProt 26–130 Author chain Kc； PDBConstruct 1–104； UniProt 26–130 Author chain Kd； PDBConstruct 1–104； UniProt 26–130 Author chain Ke； PDBConstruct 1–104； UniProt 26–130 Author chain Kf； PDBConstruct 1–104； UniProt 26–130 Author chain Kg； PDBConstruct 1–104； UniProt 26–130 Author chain Kh； PDBConstruct 1–104； UniProt 26–130 Author chain Ki； PDBConstruct 1–104； UniProt 26–130 Author chain Kj； PDBConstruct 1–104； UniProt 26–130 Author chain Kk； PDBConstruct 1–104； UniProt 26–130 Author chain Kl； PDBConstruct 1–104； UniProt 26–130 Author chain Km； PDBConstruct 1–104； UniProt 26–130 Author chain Kn； PDBConstruct 1–104； UniProt 26–130 Author chain Ko； PDBConstruct 1–104； UniProt 26–130 Author chain Kp； PDBConstruct 1–104； UniProt 26–130 Author chain Kq； PDBConstruct 1–104； UniProt 26–130 Author chain Kr； PDBConstruct 1–104； UniProt 26–130 Author chain Ks； PDBConstruct 1–104； UniProt 26–130 Author chain Kt； PDBConstruct 1–104； UniProt 26–130 Author chain Ku； PDBConstruct 1–104； UniProt 26–130 Author chain Kv； PDBConstruct 1–104； UniProt 26–130 Author chain Kw； PDBConstruct 1–104； UniProt 26–130 Author chain Kx； PDBConstruct 1–104； UniProt 26–130 Author chain Ky； PDBConstruct 1–104； UniProt 26–130 Author chain Kz； PDBConstruct 1–104； UniProt 26–130 Author chain La； PDBConstruct 1–104； UniProt 26–130 Author chain Lb； PDBConstruct 1–104； UniProt 26–130 Author chain Lc； PDBConstruct 1–104； UniProt 26–130 Author chain Ld； PDBConstruct 1–104； UniProt 26–130 Author chain Le； PDBConstruct 1–104； UniProt 26–130 Author chain Lf； PDBConstruct 1–104； UniProt 26–130 Author chain Lg； PDBConstruct 1–104； UniProt 26–130 Author chain Lh； PDBConstruct 1–104； UniProt 26–130 Author chain Li； PDBConstruct 1–104； UniProt 26–130 Author chain Lj； PDBConstruct 1–104； UniProt 26–130 Author chain Lk； PDBConstruct 1–104； UniProt 26–130 Author chain Ll； PDBConstruct 1–104； UniProt 26–130 Author chain Lm； PDBConstruct 1–104； UniProt 26–130 Author chain Ln； PDBConstruct 1–104； UniProt 26–130 Author chain Lo； PDBConstruct 1–104； UniProt 26–130 Author chain Lp； PDBConstruct 1–104； UniProt 26–130 Author chain Lq； PDBConstruct 1–104； UniProt 26–130 Author chain Lr； PDBConstruct 1–104； UniProt 26–130 Author chain Ls； PDBConstruct 1–104； UniProt 26–130 Author chain Lt； PDBConstruct 1–104； UniProt 26–130 Author chain Lu； PDBConstruct 1–104； UniProt 26–130 Author chain Lv； PDBConstruct 1–104； UniProt 26–130 Author chain Lw； PDBConstruct 1–104； UniProt 26–130 Author chain Lx； PDBConstruct 1–104； UniProt 26–130 Author chain Ly； PDBConstruct 1–104； UniProt 26–130 Author chain Lz； PDBConstruct 1–104； UniProt 26–130 Author chain Ma； PDBConstruct 1–104； UniProt 26–130 Author chain Mb； PDBConstruct 1–104； UniProt 26–130 Author chain Mc； PDBConstruct 1–104； UniProt 26–130

Chemotaxis protein PomB

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KTK9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 407	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KTK9_VIBCH
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Ix； PDBConstruct 1–155； UniProt 146–300 Author chain Iy； PDBConstruct 1–155； UniProt 146–300 Author chain Iz； PDBConstruct 1–155； UniProt 146–300 Author chain Ja； PDBConstruct 1–155； UniProt 146–300 Author chain Jb； PDBConstruct 1–155； UniProt 146–300 Author chain Jc； PDBConstruct 1–155； UniProt 146–300 Author chain Jd； PDBConstruct 1–155； UniProt 146–300 Author chain Je； PDBConstruct 1–155； UniProt 146–300 Author chain Jf； PDBConstruct 1–155； UniProt 146–300 Author chain Jg； PDBConstruct 1–155； UniProt 146–300 Author chain Jh； PDBConstruct 1–155； UniProt 146–300 Author chain Ji； PDBConstruct 1–155； UniProt 146–300 Author chain Jj； PDBConstruct 1–155； UniProt 146–300 Author chain Jk； PDBConstruct 1–155； UniProt 146–300 Author chain Jl； PDBConstruct 1–155； UniProt 146–300 Author chain Jm； PDBConstruct 1–155； UniProt 146–300 Author chain Jn； PDBConstruct 1–155； UniProt 146–300 Author chain Jo； PDBConstruct 1–155； UniProt 146–300 Author chain Jp； PDBConstruct 1–155； UniProt 146–300 Author chain Jq； PDBConstruct 1–155； UniProt 146–300 Author chain Jr； PDBConstruct 1–155； UniProt 146–300 Author chain Js； PDBConstruct 1–155； UniProt 146–300 Author chain Jt； PDBConstruct 1–155； UniProt 146–300 Author chain Ju； PDBConstruct 1–155； UniProt 146–300 Author chain Jv； PDBConstruct 1–155； UniProt 146–300 Author chain Jw； PDBConstruct 1–155； UniProt 146–300

FlgO domain-containing protein

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ00

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 407	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） Flagellar M-ring protein × 34 （Q9KQ69）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KQ00_VIBCH
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain Md； PDBConstruct 1–190； UniProt 32–221 Author chain Me； PDBConstruct 1–190； UniProt 32–221 Author chain Mf； PDBConstruct 1–190； UniProt 32–221 Author chain Mg； PDBConstruct 1–190； UniProt 32–221 Author chain Mh； PDBConstruct 1–190； UniProt 32–221 Author chain Mi； PDBConstruct 1–190； UniProt 32–221 Author chain Mj； PDBConstruct 1–190； UniProt 32–221 Author chain Mk； PDBConstruct 1–190； UniProt 32–221 Author chain Ml； PDBConstruct 1–190； UniProt 32–221 Author chain Mm； PDBConstruct 1–190； UniProt 32–221 Author chain Mn； PDBConstruct 1–190； UniProt 32–221 Author chain Mo； PDBConstruct 1–190； UniProt 32–221 Author chain Mp； PDBConstruct 1–190； UniProt 32–221 Author chain Mq； PDBConstruct 1–190； UniProt 32–221 Author chain Mr； PDBConstruct 1–190； UniProt 32–221 Author chain Ms； PDBConstruct 1–190； UniProt 32–221 Author chain Mt； PDBConstruct 1–190； UniProt 32–221 Author chain Mu； PDBConstruct 1–190； UniProt 32–221 Author chain Mv； PDBConstruct 1–190； UniProt 32–221 Author chain Mw； PDBConstruct 1–190； UniProt 32–221 Author chain Mx； PDBConstruct 1–190； UniProt 32–221 Author chain My； PDBConstruct 1–190； UniProt 32–221 Author chain Mz； PDBConstruct 1–190； UniProt 32–221 Author chain Na； PDBConstruct 1–190； UniProt 32–221 Author chain Nb； PDBConstruct 1–190； UniProt 32–221 Author chain Nc； PDBConstruct 1–190； UniProt 32–221 Author chain Nd； PDBConstruct 1–190； UniProt 32–221 Author chain Ne； PDBConstruct 1–190； UniProt 32–221 Author chain Nf； PDBConstruct 1–190； UniProt 32–221 Author chain Ng； PDBConstruct 1–190； UniProt 32–221 Author chain Nh； PDBConstruct 1–190； UniProt 32–221 Author chain Ni； PDBConstruct 1–190； UniProt 32–221 Author chain Nj； PDBConstruct 1–190； UniProt 32–221 Author chain Nk； PDBConstruct 1–190； UniProt 32–221 Author chain Nl； PDBConstruct 1–190； UniProt 32–221 Author chain Nm； PDBConstruct 1–190； UniProt 32–221 Author chain Nn； PDBConstruct 1–190； UniProt 32–221 Author chain No； PDBConstruct 1–190； UniProt 32–221 Author chain Np； PDBConstruct 1–190； UniProt 32–221 Author chain Nq； PDBConstruct 1–190； UniProt 32–221 Author chain Nr； PDBConstruct 1–190； UniProt 32–221 Author chain Ns； PDBConstruct 1–190； UniProt 32–221 Author chain Nt； PDBConstruct 1–190； UniProt 32–221 Author chain Nu； PDBConstruct 1–190； UniProt 32–221 Author chain Nv； PDBConstruct 1–190； UniProt 32–221 Author chain Nw； PDBConstruct 1–190； UniProt 32–221 Author chain Nx； PDBConstruct 1–190； UniProt 32–221 Author chain Ny； PDBConstruct 1–190； UniProt 32–221 Author chain Nz； PDBConstruct 1–190； UniProt 32–221 Author chain Oa； PDBConstruct 1–190； UniProt 32–221 Author chain Ob； PDBConstruct 1–190； UniProt 32–221 Author chain Oc； PDBConstruct 1–190； UniProt 32–221 Author chain Od； PDBConstruct 1–190； UniProt 32–221 Author chain Oe； PDBConstruct 1–190； UniProt 32–221 Author chain Of； PDBConstruct 1–190； UniProt 32–221 Author chain Og； PDBConstruct 1–190； UniProt 32–221 Author chain Oh； PDBConstruct 1–190； UniProt 32–221 Author chain Oi； PDBConstruct 1–190； UniProt 32–221

Flagellar M-ring protein

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ69

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 407	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KQ69_VIBCH
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Oj； PDBConstruct 1–198； UniProt 256–453 Author chain Ok； PDBConstruct 1–198； UniProt 256–453 Author chain Ol； PDBConstruct 1–198； UniProt 256–453 Author chain Om； PDBConstruct 1–198； UniProt 256–453 Author chain On； PDBConstruct 1–198； UniProt 256–453 Author chain Oo； PDBConstruct 1–198； UniProt 256–453 Author chain Op； PDBConstruct 1–198； UniProt 256–453 Author chain Oq； PDBConstruct 1–198； UniProt 256–453 Author chain Or； PDBConstruct 1–198； UniProt 256–453 Author chain Os； PDBConstruct 1–198； UniProt 256–453 Author chain Ot； PDBConstruct 1–198； UniProt 256–453 Author chain Ou； PDBConstruct 1–198； UniProt 256–453 Author chain Ov； PDBConstruct 1–198； UniProt 256–453 Author chain Ow； PDBConstruct 1–198； UniProt 256–453 Author chain Ox； PDBConstruct 1–198； UniProt 256–453 Author chain Oy； PDBConstruct 1–198； UniProt 256–453 Author chain Oz； PDBConstruct 1–198； UniProt 256–453 Author chain Pa； PDBConstruct 1–198； UniProt 256–453 Author chain Pb； PDBConstruct 1–198； UniProt 256–453 Author chain Pc； PDBConstruct 1–198； UniProt 256–453 Author chain Pd； PDBConstruct 1–198； UniProt 256–453 Author chain Pe； PDBConstruct 1–198； UniProt 256–453 Author chain Pf； PDBConstruct 1–198； UniProt 256–453 Author chain Pg； PDBConstruct 1–198； UniProt 256–453 Author chain Ph； PDBConstruct 1–198； UniProt 256–453 Author chain Pi； PDBConstruct 1–198； UniProt 256–453 Author chain Pj； PDBConstruct 1–198； UniProt 256–453 Author chain Pk； PDBConstruct 1–198； UniProt 256–453 Author chain Pl； PDBConstruct 1–198； UniProt 256–453 Author chain Pm； PDBConstruct 1–198； UniProt 256–453 Author chain Pn； PDBConstruct 1–198； UniProt 256–453 Author chain Po； PDBConstruct 1–198； UniProt 256–453 Author chain Pp； PDBConstruct 1–198； UniProt 256–453 Author chain Pq； PDBConstruct 1–198； UniProt 256–453

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9yh7
Deposition date deposition_date	2025-09-30
Structure title title	Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a higher FOMC conformation
Keywords keywords	Motor protein, Sheathed flagellar motor, Vibrio cholerae; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9yh7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9yh7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9yh7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	152.00 Å
Total Rg	152.00 Å
Atom count	574924
Residues	73994
Excluded volume	10160000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9yh7__assembly_1__model_1`	407-meric （407）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	Flagellar basal-body rod protein FlgG
Molecular weight formula_weight	28114.3 kDa
Source method src_method	man
Copy count entity_count	27

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa,Ab,Ac,Ad,Ae,Af,Ag,Ah,Ai,Aj,Ak,Al,Am,An,Ao,Ap,Aq,Ar,As,At,Au,Av,Aw,Ax,Ay,Az,Bb
Atom count atom_count	574924

MQPALWVSKTGLDAQQTNIATISNNLANASTIGFKKGRAVFEDLFYQNINQPGAQSSQNTRLPSGLMLGAGSKVVATQKVHTNGNVQTTSNSLDMMIEGDGFFQILMPDGNIAYSRNGQFTLDDEGAIVTSGAGYRLQPEIIIPEDAISITIGNDGEVSVRVRGQQDNQVLGQITTVDFINPGGLEPVGQNLYLPTGASGEPQEGVPGLDGLGDIRQSMLETSNVNVTEELVNMIEAQRVYEMNSKVISAVDKMMSFVNQQL

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 2 Entity 2 polymer

Description description	Flagellar basal-body rod protein FlgF
Molecular weight formula_weight	26778.3 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ba,Bc,Bd,Bv,Bw

MDRALFLAMSGAKQNMQAMQLRANNLANVSTTGFRADLAQARSMQAYGEGLPSRVFSMTERPGHNFAQGSVITTGRDLDITIQGDGWISVLDKTGKEGLTRNGNLRIDETGLLLNGNGHPVLGETGAPITLPVPLNKVEIGGDGTISVRPQGAPADAMEVVDRIKLVRLNDQSLFKDVNGLFRATDPNTQFEADASVKILTGALEGSNVNAIGEMTSLIDLQRQFEMQVKMMSTAEEMDKASDSLLRSS

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 3 Entity 3 polymer

Description description	Flagellar hook protein FlgE
Molecular weight formula_weight	46880.3 kDa
Source method src_method	man
Copy count entity_count	17

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Be,Bf,Bg,Bh,Bi,Bj,Bk,Bl,Bm,Bn,Bo,Bp,Bq,Br,Bs,Bt,Bu

MSYVSLSGLSAAQMDLNTTSNNIANANTFGFKESRAEFGDVYSTSLFTNAKTTPGQGVQAAKVAQQFHEGSSIYTNNPLDLRIAGTGFFAVAKDRLVPQQNELTRNGAFHLDKNSFMVTANDEFLLGYEVNPDTGDVLSYEPKPINIPPQFGKPKQTANIDLGANLPANGDLKDPALFDITDPETYNRTTSSTIYDSMGQPYKLTTYYLKDMNQANTWQTYYTVTDKTGEKPINVVGGDAASPTGHVGHTMRFNNDGTLSSLNNGQPIVTEPLGGGANPVDLNGADVNQTLSFSLDSATQFAAPFELTKFDQDGATTGFLTKIDFDENGSVLATYSNGINTTLGRVALVRVANEQGLDKKGGTQWDATQFSGAKIWGESNKGSFGSISNGSLEQSNIDMTQELVDLISAQRNFQANSRALEVHNGLQQNILQIR

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 4 Entity 4 polymer

Description description	Flagellar L-ring protein
Molecular weight formula_weight	24256.5 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bx,By,Bz,Ca,Cb,Cc,Cd,Ce,Cf,Cg,Ch,Ci,Cj,Ck,Cl,Cm,Cn,Co,Cp,Cq,Cr,Cs,Ct,Cu,Cv,Cw

TTTVDAVEGDKSESNSGLTDALRNRTDPVAGDPAWAPIHPKGKPEHYAAETGSLFNLASSSSMYDDSKPRGVGDIITVTLNESTKAAKSADADLNKKNDASMDPLAVGGKDLTIGDYNFSYALKNDNKFSGSAAANQSNSMSGSITVEVIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEPGFLARFFNVSL

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 5 Entity 5 polymer

Description description	Flagellar P-ring protein
Molecular weight formula_weight	35702.6 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Cx,Cy,Cz,Da,Db,Dc,Dd,De,Df,Dg,Dh,Di,Dj,Dk,Dl,Dm,Dn,Do,Dp,Dq,Dr,Ds,Dt,Du,Dv,Dw

ARIKDVAQVAGVRNNQLVGYGLVTGLPGTGESTPFTDQSFNAMLQSFGIQLPPGTKPKTKNVAAVIVTADLPAFSKQGQTIDITVSSIGSAKSLRGGTLMQTFLKGLDGQVYAVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGDYITFNLFESDFTTAQRLADAVNQFLGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENLEFNPADSAAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNALGGGQTVVVPNTEIEVTEKQGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLIII

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 6 Entity 6 polymer

Description description	Flagellar protein FlgT
Molecular weight formula_weight	39808.2 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Dx,Dy,Dz,Ea,Eb,Ec,Ed,Ee,Ef,Eg,Eh,Ei,Ej,Ek,El,Em,En,Eo,Ep,Eq,Er,Es,Et,Eu,Ev,Ew

YEVTGSAAIVSSEEVARLHALEDALYKAVNFAGADIGSISNLMPLLESDRREYLFANHEVRYILIEERKAINNVMYVRTRIDIYPSATACHVEQYKKTMLIGNIDLASPQQAVMGQIYQVGDDFAQVINRRLEQESRSFVSVGTTQYDIDPKAPERIKMIAQDAGAQYIMGGMITDLTATIEQKTLQDDIINRQFAMEISVFDGKTGNEVMTRTYREVARWPFPKTSQIDTRSARFWASTYGEMMLRVSRNIMLDLESEISCKITLPQIVAKFGTTATMDLGRIHGVKQGDKLSLWHTGAFIDQQGLPRNKVTQSEITLTVSRVYEHEAELTVDQPELAYSIQIGDVMHKQM

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 7 Entity 7 polymer

Description description	Sodium-type flagellar protein MotY
Molecular weight formula_weight	31208.0 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ex,Ey,Ez,Fa,Fb,Fc,Fd,Fe,Ff,Fg,Fh,Fi,Fj,Fk,Fl,Fm,Fn,Fo,Fp,Fq,Fr,Fs,Ft,Fu,Fv,Fw

LEVRYMATPQQSTWQMATNTPLECRLVHPIPNYGDAEFSSRAGKKINLDFELKMRRPMGDTRNVSLVSMPPVWRPGEGADRITNLQFFKQFDGYIGGQTAWSLLSELEKGRYPTFSYQDWQSRDQRIEVALSSVLFQQPYNEFSDCISKLLPYSFEDISFTILHYDQGTSVELNKASQKRLAQIAEYVRYNQDIDLVLVSTYTDSTDTNNNSQNLSEQRAEVLREYFKSIGLPEDRIQVQGYGKRRPIADNASPIGKDKNRRVVISLGRTQ

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 8 Entity 8 polymer

Description description	Sodium-type flagellar protein MotX
Molecular weight formula_weight	21244.1 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Fx,Fy,Fz,Ga,Gb,Gc,Gd,Ge,Gf,Gg,Gh,Gi,Gj,Gk,Gl,Gm,Gn,Go,Gp,Gq,Gr,Gs,Gt,Gu,Gv,Gw

PVPIYSEAELIKLIEENKHLERVKADNCQIVEDIVARATRISLPSYEFLYGDMLAWGVCVDQDVELGLYYMENAAHQGLPAALEQLGRYYSRGTLVQQDKERAIPYLREAAAMGNLNARIQLAELLLRDYGSPLDYEDAYRWLYNSVTADQRTHNRIALLRQGLERRMPENIIARAKRRETFW

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 9 Entity 9 polymer

Description description	FlgP
Molecular weight formula_weight	1506.8 kDa
Source method src_method	man
Copy count entity_count	52

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;Gx,Gy,Gz,Ha,Hb,Hc,Hd,He,Hf,Hg,Hh,Hi,Hj,Hk,Hl,Hm,Hn,Ho,Hp,Hq,Hr,Hs,Ht,Hu,Hv,Hw,Hx,Hy,Hz,Ia,Ib,Ic,Id,Ie,If,Ig,Ih,Ii,Ij,Ik,Il,Im,In,Io,Ip,Iq,Ir,Is,It,Iu,Iv,Iw ;

QQVPEKRQMTLF

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 10 Entity 10 polymer

Description description	Chemotaxis protein PomB
Molecular weight formula_weight	17542.8 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ix,Iy,Iz,Ja,Jb,Jc,Jd,Je,Jf,Jg,Jh,Ji,Jj,Jk,Jl,Jm,Jn,Jo,Jp,Jq,Jr,Js,Jt,Ju,Jv,Jw

QQQAQAMSEQMETVAESIKKALSREIEQGAIEVENLGQQIDIRIREKGAFPEGSAFLQPKFRPLVRQIAELVKDIPGKVRVTGHTDNQKLDSELYRSNWDLSAQRAVSVAQEMEKVKDFDHLRLQVRGLADTQPLGPNDTEAQRATNRRVEISIL

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 11 Entity 11 polymer

Description description	FlgP
Molecular weight formula_weight	11848.3 kDa
Source method src_method	man
Copy count entity_count	58

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;Jx,Jy,Jz,Ka,Kb,Kc,Kd,Ke,Kf,Kg,Kh,Ki,Kj,Kk,Kl,Km,Kn,Ko,Kp,Kq,Kr,Ks,Kt,Ku,Kv,Kw,Kx,Ky,Kz,La,Lb,Lc,Ld,Le,Lf,Lg,Lh,Li,Lj,Lk,Ll,Lm,Ln,Lo,Lp,Lq,Lr,Ls,Lt,Lu,Lv,Lw,Lx,Ly,Lz,Ma,Mb,Mc ;

PDDWLTAVGYANISEQRGRDEAEKQVRAMRASKIDAYRELAEQVYGMRISGRAELQDQRLGTELTAGADGVIRGAEVVRSYKVGDSYVTELRLDIRKMDKMRDY

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 12 Entity 12 polymer

Description description	FlgO domain-containing protein
Molecular weight formula_weight	21395.1 kDa
Source method src_method	man
Copy count entity_count	58

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;Md,Me,Mf,Mg,Mh,Mi,Mj,Mk,Ml,Mm,Mn,Mo,Mp,Mq,Mr,Ms,Mt,Mu,Mv,Mw,Mx,My,Mz,Na,Nb,Nc,Nd,Ne,Nf,Ng,Nh,Ni,Nj,Nk,Nl,Nm,Nn,No,Np,Nq,Nr,Ns,Nt,Nu,Nv,Nw,Nx,Ny,Nz,Oa,Ob,Oc,Od,Oe,Of,Og,Oh,Oi ;

IYNGKEPYNGSQFMLMESPRHTLDFFVESMTEDLMLSNTSITARTPIAVTSFVDLQNMDTTNWLGNSVSEGFIHQFQRRGFKVVDFKTTGSIQVTQQGDFAFSRDWKNLSSEQEVQYVLTGTMLRQEGGVIVNARVVGMHSRIVVATAQGFLPADRIGRDLDTLNSIRTQDGVLIRSDPTITQPYTVILR

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 13 Entity 13 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	21495.8 kDa
Source method src_method	man
Copy count entity_count	34

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Oj,Ok,Ol,Om,On,Oo,Op,Oq,Or,Os,Ot,Ou,Ov,Ow,Ox,Oy,Oz,Pa,Pb,Pc,Pd,Pe,Pf,Pg,Ph,Pi,Pj,Pk,Pl,Pm,Pn,Po,Pp,Pq

VSAARRKEQELEKQQEEALRGKIDSVLIPILGLGNYTAQVDIELDFSAVEQTRKVFDPNTPATRSEYTLEDYNNGNVVAGVPGALSNQPPADASIPQDVAQMKDGSVMGQGSVHKEATRNYELDTTISHERKQSGVINRQTVAVAVKSRSSVNPDTGEVTYTPLSEADLNSIRQVLIGTVGYSENRGDLLNVLSMPFA

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	5068

Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a higher FOMC conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook protein FlgE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar L-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar P-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar protein FlgT

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sodium-type flagellar protein MotY

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sodium-type flagellar protein MotX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

FlgP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chemotaxis protein PomB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer