9yh7

Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a higher FOMC conformation

Method: ELECTRON MICROSCOPY D_max: 471.4 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

Vibrio cholerae O1 biovar El Tor str. N16961

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 407 PDB declaration: 407-meric（407） Consistent with protein copy count	Chain Aa； UniProt 1–262 Chain Ab； UniProt 1–262 Chain Ac； UniProt 1–262 Chain Ad； UniProt 1–262 Chain Ae； UniProt 1–262 Chain Af； UniProt 1–262 Chain Ag； UniProt 1–262 Chain Ah； UniProt 1–262 Chain Ai； UniProt 1–262 Chain Aj； UniProt 1–262 Chain Ak； UniProt 1–262 Chain Al； UniProt 1–262 Chain Am； UniProt 1–262 Chain An； UniProt 1–262 Chain Ao； UniProt 1–262 Chain Ap； UniProt 1–262 Chain Aq； UniProt 1–262 Chain Ar； UniProt 1–262 Chain As； UniProt 1–262 Chain At； UniProt 1–262 Chain Au； UniProt 1–262 Chain Av； UniProt 1–262 Chain Aw； UniProt 1–262 Chain Ax； UniProt 1–262 Chain Ay； UniProt 1–262 Chain Az； UniProt 1–262 Chain Bb； UniProt 1–262	Not recorded	Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.60 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9YH7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YEE Rod-hook protein in Vibrio cholerae at assembled, opened state Deposited 2025-09-24	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 49 PDB declaration: 49-meric	Chain Ba 1–262（262 aa） Chain Bb 1–262（262 aa） Chain Bc 1–262（262 aa） Chain Bd 1–262（262 aa） Chain Be 1–262（262 aa） Chain Bf 1–262（262 aa） Chain Bg 1–262（262 aa） Chain Bh 1–262（262 aa） Chain Bi 1–262（262 aa） Chain Bj 1–262（262 aa） Chain Bk 1–262（262 aa） Chain Bl 1–262（262 aa） Chain Bm 1–262（262 aa） Chain Bn 1–262（262 aa） Chain Bo 1–262（262 aa） Chain Bp 1–262（262 aa） Chain Bq 1–262（262 aa） Chain Br 1–262（262 aa） Chain Bs 1–262（262 aa） Chain Bt 1–262（262 aa） Chain Bu 1–262（262 aa） Chain Bv 1–262（262 aa） Chain Bw 1–262（262 aa） Chain Bx 1–262（262 aa） Chain By 1–262（262 aa） Chain Bz 1–262（262 aa） Chain Cb 1–262（262 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.44 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Aa 1–262（262 aa） Chain Ab 1–262（262 aa） Chain Ac 1–262（262 aa） Chain Ad 1–262（262 aa） Chain Ae 1–262（262 aa） Chain Af 1–262（262 aa） Chain Ag 1–262（262 aa） Chain Ah 1–262（262 aa） Chain Ai 1–262（262 aa） Chain Aj 1–262（262 aa） Chain Ak 1–262（262 aa） Chain Al 1–262（262 aa） Chain Am 1–262（262 aa） Chain An 1–262（262 aa） Chain Ao 1–262（262 aa） Chain Ap 1–262（262 aa） Chain Aq 1–262（262 aa） Chain Ar 1–262（262 aa） Chain As 1–262（262 aa） Chain At 1–262（262 aa） Chain Au 1–262（262 aa） Chain Av 1–262（262 aa） Chain Aw 1–262（262 aa） Chain Ax 1–262（262 aa） Chain Ay 1–262（262 aa） Chain Az 1–262（262 aa） Chain Bb 1–262（262 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9KQ12_VIBCH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–262； UniProt 1–262 Author chain Ab； PDBConstruct 1–262； UniProt 1–262 Author chain Ac； PDBConstruct 1–262； UniProt 1–262 Author chain Ad； PDBConstruct 1–262； UniProt 1–262 Author chain Ae； PDBConstruct 1–262； UniProt 1–262 Author chain Af； PDBConstruct 1–262； UniProt 1–262 Author chain Ag； PDBConstruct 1–262； UniProt 1–262 Author chain Ah； PDBConstruct 1–262； UniProt 1–262 Author chain Ai； PDBConstruct 1–262； UniProt 1–262 Author chain Aj； PDBConstruct 1–262； UniProt 1–262 Author chain Ak； PDBConstruct 1–262； UniProt 1–262 Author chain Al； PDBConstruct 1–262； UniProt 1–262 Author chain Am； PDBConstruct 1–262； UniProt 1–262 Author chain An； PDBConstruct 1–262； UniProt 1–262 Author chain Ao； PDBConstruct 1–262； UniProt 1–262 Author chain Ap； PDBConstruct 1–262； UniProt 1–262 Author chain Aq； PDBConstruct 1–262； UniProt 1–262 Author chain Ar； PDBConstruct 1–262； UniProt 1–262 Author chain As； PDBConstruct 1–262； UniProt 1–262 Author chain At； PDBConstruct 1–262； UniProt 1–262 Author chain Au； PDBConstruct 1–262； UniProt 1–262 Author chain Av； PDBConstruct 1–262； UniProt 1–262 Author chain Aw； PDBConstruct 1–262； UniProt 1–262 Author chain Ax； PDBConstruct 1–262； UniProt 1–262 Author chain Ay； PDBConstruct 1–262； UniProt 1–262 Author chain Az； PDBConstruct 1–262； UniProt 1–262 Author chain Bb； PDBConstruct 1–262； UniProt 1–262

Flagellar basal-body rod protein FlgF

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ11

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 407 PDB declaration: 407-meric（407） Consistent with protein copy count	Chain Ba； UniProt 1–249 Chain Bc； UniProt 1–249 Chain Bd； UniProt 1–249 Chain Bv； UniProt 1–249 Chain Bw； UniProt 1–249	Not recorded	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YH7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YEE Rod-hook protein in Vibrio cholerae at assembled, opened state Deposited 2025-09-24	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 49 PDB declaration: 49-meric	Chain Ca 1–249（249 aa） Chain Cc 1–249（249 aa） Chain Cd 1–249（249 aa） Chain Cv 1–249（249 aa） Chain Cw 1–249（249 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.44 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Ba 1–249（249 aa） Chain Bc 1–249（249 aa） Chain Bd 1–249（249 aa） Chain Bv 1–249（249 aa） Chain Bw 1–249（249 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9KQ11_VIBCH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain Ba； PDBConstruct 1–249； UniProt 1–249 Author chain Bc； PDBConstruct 1–249； UniProt 1–249 Author chain Bd； PDBConstruct 1–249； UniProt 1–249 Author chain Bv； PDBConstruct 1–249； UniProt 1–249 Author chain Bw； PDBConstruct 1–249； UniProt 1–249

Flagellar hook protein FlgE

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt A0A085QTL5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 407 PDB declaration: 407-meric（407） Consistent with protein copy count	Chain Be； UniProt 1–434 Chain Bf； UniProt 1–434 Chain Bg； UniProt 1–434 Chain Bh； UniProt 1–434 Chain Bi； UniProt 1–434 Chain Bj； UniProt 1–434 Chain Bk； UniProt 1–434 Chain Bl； UniProt 1–434 Chain Bm； UniProt 1–434 Chain Bn； UniProt 1–434 Chain Bo； UniProt 1–434 Chain Bp； UniProt 1–434 Chain Bq； UniProt 1–434 Chain Br； UniProt 1–434 Chain Bs； UniProt 1–434 Chain Bt； UniProt 1–434 Chain Bu； UniProt 1–434	Not recorded	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.60 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A085QTL5_VIBCL
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain Be； PDBConstruct 1–434； UniProt 1–434 Author chain Bf； PDBConstruct 1–434； UniProt 1–434 Author chain Bg； PDBConstruct 1–434； UniProt 1–434 Author chain Bh； PDBConstruct 1–434； UniProt 1–434 Author chain Bi； PDBConstruct 1–434； UniProt 1–434 Author chain Bj； PDBConstruct 1–434； UniProt 1–434 Author chain Bk； PDBConstruct 1–434； UniProt 1–434 Author chain Bl； PDBConstruct 1–434； UniProt 1–434 Author chain Bm； PDBConstruct 1–434； UniProt 1–434 Author chain Bn； PDBConstruct 1–434； UniProt 1–434 Author chain Bo； PDBConstruct 1–434； UniProt 1–434 Author chain Bp； PDBConstruct 1–434； UniProt 1–434 Author chain Bq； PDBConstruct 1–434； UniProt 1–434 Author chain Br； PDBConstruct 1–434； UniProt 1–434 Author chain Bs； PDBConstruct 1–434； UniProt 1–434 Author chain Bt； PDBConstruct 1–434； UniProt 1–434 Author chain Bu； PDBConstruct 1–434； UniProt 1–434

Flagellar L-ring protein

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ13

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 407 PDB declaration: 407-meric（407） Consistent with protein copy count	Chain Bx； UniProt 32–258 Chain By； UniProt 32–258 Chain Bz； UniProt 32–258 Chain Ca； UniProt 32–258 Chain Cb； UniProt 32–258 Chain Cc； UniProt 32–258 Chain Cd； UniProt 32–258 Chain Ce； UniProt 32–258 Chain Cf； UniProt 32–258 Chain Cg； UniProt 32–258 Chain Ch； UniProt 32–258 Chain Ci； UniProt 32–258 Chain Cj； UniProt 32–258 Chain Ck； UniProt 32–258 Chain Cl； UniProt 32–258 Chain Cm； UniProt 32–258 Chain Cn； UniProt 32–258 Chain Co； UniProt 32–258 Chain Cp； UniProt 32–258 Chain Cq； UniProt 32–258 Chain Cr； UniProt 32–258 Chain Cs； UniProt 32–258 Chain Ct； UniProt 32–258 Chain Cu； UniProt 32–258 Chain Cv； UniProt 32–258 Chain Cw； UniProt 32–258	Not recorded	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YH7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YDO LPHT-ring in Vibrio cholerae at assembled, opened state Deposited 2025-09-22	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Aa 32–258（227 aa） Chain Ab 32–258（227 aa） Chain Ac 32–258（227 aa） Chain Ad 32–258（227 aa） Chain Ae 32–258（227 aa） Chain Af 32–258（227 aa） Chain Ag 32–258（227 aa） Chain Ah 32–258（227 aa） Chain Ai 32–258（227 aa） Chain Aj 32–258（227 aa） Chain Ak 32–258（227 aa） Chain Al 32–258（227 aa） Chain Am 32–258（227 aa） Chain An 32–258（227 aa） Chain Ao 32–258（227 aa） Chain Ap 32–258（227 aa） Chain Aq 32–258（227 aa） Chain Ar 32–258（227 aa） Chain As 32–258（227 aa） Chain At 32–258（227 aa） Chain Au 32–258（227 aa） Chain Av 32–258（227 aa） Chain Aw 32–258（227 aa） Chain Ax 32–258（227 aa） Chain Ay 32–258（227 aa） Chain Az 32–258（227 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.69 Å
9YDT LPHT-ring in Vibrio cholerae at disassembled, closed state Deposited 2025-09-23	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Aa 32–258（227 aa） Chain Ab 32–258（227 aa） Chain Ac 32–258（227 aa） Chain Ad 32–258（227 aa） Chain Ae 32–258（227 aa） Chain Af 32–258（227 aa） Chain Ag 32–258（227 aa） Chain Ah 32–258（227 aa） Chain Ai 32–258（227 aa） Chain Aj 32–258（227 aa） Chain Ak 32–258（227 aa） Chain Al 32–258（227 aa） Chain Am 32–258（227 aa） Chain An 32–258（227 aa） Chain Ao 32–258（227 aa） Chain Ap 32–258（227 aa） Chain Aq 32–258（227 aa） Chain Ar 32–258（227 aa） Chain As 32–258（227 aa） Chain At 32–258（227 aa） Chain Au 32–258（227 aa） Chain Av 32–258（227 aa） Chain Aw 32–258（227 aa） Chain Ax 32–258（227 aa） Chain Ay 32–258（227 aa） Chain Az 32–258（227 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.75 Å
9YEC LPHT-ring in Vibrio cholerae at disassembled, closed state Deposited 2025-09-24	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Aa 1–258（258 aa） Chain Ab 1–258（258 aa） Chain Ac 1–258（258 aa） Chain Ad 1–258（258 aa） Chain Ae 1–258（258 aa） Chain Af 1–258（258 aa） Chain Ag 1–258（258 aa） Chain Ah 1–258（258 aa） Chain Ai 1–258（258 aa） Chain Aj 1–258（258 aa） Chain Ak 1–258（258 aa） Chain Al 1–258（258 aa） Chain Am 1–258（258 aa） Chain An 1–258（258 aa） Chain Ao 1–258（258 aa） Chain Ap 1–258（258 aa） Chain Aq 1–258（258 aa） Chain Ar 1–258（258 aa） Chain As 1–258（258 aa） Chain At 1–258（258 aa） Chain Au 1–258（258 aa） Chain Av 1–258（258 aa） Chain Aw 1–258（258 aa） Chain Ax 1–258（258 aa） Chain Ay 1–258（258 aa） Chain Az 1–258（258 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.57 Å
9YFG Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state Deposited 2025-09-25	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 298 PDB declaration: 298-meric	Chain Aa 32–258（227 aa） Chain Ab 32–258（227 aa） Chain Ac 32–258（227 aa） Chain Ad 32–258（227 aa） Chain Ae 32–258（227 aa） Chain Af 32–258（227 aa） Chain Ag 32–258（227 aa） Chain Ah 32–258（227 aa） Chain Ai 32–258（227 aa） Chain Aj 32–258（227 aa） Chain Ak 32–258（227 aa） Chain Al 32–258（227 aa） Chain Am 32–258（227 aa） Chain An 32–258（227 aa） Chain Ao 32–258（227 aa） Chain Ap 32–258（227 aa） Chain Aq 32–258（227 aa） Chain Ar 32–258（227 aa） Chain As 32–258（227 aa） Chain At 32–258（227 aa） Chain Au 32–258（227 aa） Chain Av 32–258（227 aa） Chain Aw 32–258（227 aa） Chain Ax 32–258（227 aa） Chain Ay 32–258（227 aa） Chain Az 32–258（227 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.55 Å
9YH0 LPHT-ring subunit with C13 MotX in Vibrio cholerae at assembled state Deposited 2025-09-29	Different oligomeric state	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Aa 32–258（227 aa） Chain Ab 32–258（227 aa） Chain Ac 32–258（227 aa） Chain Ad 32–258（227 aa） Chain Ae 32–258（227 aa） Chain Af 32–258（227 aa） Chain Ag 32–258（227 aa） Chain Ah 32–258（227 aa） Chain Ai 32–258（227 aa） Chain Aj 32–258（227 aa） Chain Ak 32–258（227 aa） Chain Al 32–258（227 aa） Chain Am 32–258（227 aa） Chain An 32–258（227 aa） Chain Ao 32–258（227 aa） Chain Ap 32–258（227 aa） Chain Aq 32–258（227 aa） Chain Ar 32–258（227 aa） Chain As 32–258（227 aa） Chain At 32–258（227 aa） Chain Au 32–258（227 aa） Chain Av 32–258（227 aa） Chain Aw 32–258（227 aa） Chain Ax 32–258（227 aa） Chain Ay 32–258（227 aa） Chain Az 32–258（227 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Bx 32–258（227 aa） Chain By 32–258（227 aa） Chain Bz 32–258（227 aa） Chain Ca 32–258（227 aa） Chain Cb 32–258（227 aa） Chain Cc 32–258（227 aa） Chain Cd 32–258（227 aa） Chain Ce 32–258（227 aa） Chain Cf 32–258（227 aa） Chain Cg 32–258（227 aa） Chain Ch 32–258（227 aa） Chain Ci 32–258（227 aa） Chain Cj 32–258（227 aa） Chain Ck 32–258（227 aa） Chain Cl 32–258（227 aa） Chain Cm 32–258（227 aa） Chain Cn 32–258（227 aa） Chain Co 32–258（227 aa） Chain Cp 32–258（227 aa） Chain Cq 32–258（227 aa） Chain Cr 32–258（227 aa） Chain Cs 32–258（227 aa） Chain Ct 32–258（227 aa） Chain Cu 32–258（227 aa） Chain Cv 32–258（227 aa） Chain Cw 32–258（227 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGH_VIBCH
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Bx； PDBConstruct 1–227； UniProt 32–258 Author chain By； PDBConstruct 1–227； UniProt 32–258 Author chain Bz； PDBConstruct 1–227； UniProt 32–258 Author chain Ca； PDBConstruct 1–227； UniProt 32–258 Author chain Cb； PDBConstruct 1–227； UniProt 32–258 Author chain Cc； PDBConstruct 1–227； UniProt 32–258 Author chain Cd； PDBConstruct 1–227； UniProt 32–258 Author chain Ce； PDBConstruct 1–227； UniProt 32–258 Author chain Cf； PDBConstruct 1–227； UniProt 32–258 Author chain Cg； PDBConstruct 1–227； UniProt 32–258 Author chain Ch； PDBConstruct 1–227； UniProt 32–258 Author chain Ci； PDBConstruct 1–227； UniProt 32–258 Author chain Cj； PDBConstruct 1–227； UniProt 32–258 Author chain Ck； PDBConstruct 1–227； UniProt 32–258 Author chain Cl； PDBConstruct 1–227； UniProt 32–258 Author chain Cm； PDBConstruct 1–227； UniProt 32–258 Author chain Cn； PDBConstruct 1–227； UniProt 32–258 Author chain Co； PDBConstruct 1–227； UniProt 32–258 Author chain Cp； PDBConstruct 1–227； UniProt 32–258 Author chain Cq； PDBConstruct 1–227； UniProt 32–258 Author chain Cr； PDBConstruct 1–227； UniProt 32–258 Author chain Cs； PDBConstruct 1–227； UniProt 32–258 Author chain Ct； PDBConstruct 1–227； UniProt 32–258 Author chain Cu； PDBConstruct 1–227； UniProt 32–258 Author chain Cv； PDBConstruct 1–227； UniProt 32–258 Author chain Cw； PDBConstruct 1–227； UniProt 32–258

Flagellar P-ring protein

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ14

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 407 PDB declaration: 407-meric（407） Consistent with protein copy count	Chain Cx； UniProt 19–361 Chain Cy； UniProt 19–361 Chain Cz； UniProt 19–361 Chain Da； UniProt 19–361 Chain Db； UniProt 19–361 Chain Dc； UniProt 19–361 Chain Dd； UniProt 19–361 Chain De； UniProt 19–361 Chain Df； UniProt 19–361 Chain Dg； UniProt 19–361 Chain Dh； UniProt 19–361 Chain Di； UniProt 19–361 Chain Dj； UniProt 19–361 Chain Dk； UniProt 19–361 Chain Dl； UniProt 19–361 Chain Dm； UniProt 19–361 Chain Dn； UniProt 19–361 Chain Do； UniProt 19–361 Chain Dp； UniProt 19–361 Chain Dq； UniProt 19–361 Chain Dr； UniProt 19–361 Chain Ds； UniProt 19–361 Chain Dt； UniProt 19–361 Chain Du； UniProt 19–361 Chain Dv； UniProt 19–361 Chain Dw； UniProt 19–361	Not recorded	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YH7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YDO LPHT-ring in Vibrio cholerae at assembled, opened state Deposited 2025-09-22	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Ba 19–361（343 aa） Chain Bb 19–361（343 aa） Chain Bc 19–361（343 aa） Chain Bd 19–361（343 aa） Chain Be 19–361（343 aa） Chain Bf 19–361（343 aa） Chain Bg 19–361（343 aa） Chain Bh 19–361（343 aa） Chain Bi 19–361（343 aa） Chain Bj 19–361（343 aa） Chain Bk 19–361（343 aa） Chain Bl 19–361（343 aa） Chain Bm 19–361（343 aa） Chain Bn 19–361（343 aa） Chain Bo 19–361（343 aa） Chain Bp 19–361（343 aa） Chain Bq 19–361（343 aa） Chain Br 19–361（343 aa） Chain Bs 19–361（343 aa） Chain Bt 19–361（343 aa） Chain Bu 19–361（343 aa） Chain Bv 19–361（343 aa） Chain Bw 19–361（343 aa） Chain Bx 19–361（343 aa） Chain By 19–361（343 aa） Chain Bz 19–361（343 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.69 Å
9YDT LPHT-ring in Vibrio cholerae at disassembled, closed state Deposited 2025-09-23	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Ba 19–361（343 aa） Chain Bb 19–361（343 aa） Chain Bc 19–361（343 aa） Chain Bd 19–361（343 aa） Chain Be 19–361（343 aa） Chain Bf 19–361（343 aa） Chain Bg 19–361（343 aa） Chain Bh 19–361（343 aa） Chain Bi 19–361（343 aa） Chain Bj 19–361（343 aa） Chain Bk 19–361（343 aa） Chain Bl 19–361（343 aa） Chain Bm 19–361（343 aa） Chain Bn 19–361（343 aa） Chain Bo 19–361（343 aa） Chain Bp 19–361（343 aa） Chain Bq 19–361（343 aa） Chain Br 19–361（343 aa） Chain Bs 19–361（343 aa） Chain Bt 19–361（343 aa） Chain Bu 19–361（343 aa） Chain Bv 19–361（343 aa） Chain Bw 19–361（343 aa） Chain Bx 19–361（343 aa） Chain By 19–361（343 aa） Chain Bz 19–361（343 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.75 Å
9YEC LPHT-ring in Vibrio cholerae at disassembled, closed state Deposited 2025-09-24	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Ba 1–361（361 aa） Chain Bb 1–361（361 aa） Chain Bc 1–361（361 aa） Chain Bd 1–361（361 aa） Chain Be 1–361（361 aa） Chain Bf 1–361（361 aa） Chain Bg 1–361（361 aa） Chain Bh 1–361（361 aa） Chain Bi 1–361（361 aa） Chain Bj 1–361（361 aa） Chain Bk 1–361（361 aa） Chain Bl 1–361（361 aa） Chain Bm 1–361（361 aa） Chain Bn 1–361（361 aa） Chain Bo 1–361（361 aa） Chain Bp 1–361（361 aa） Chain Bq 1–361（361 aa） Chain Br 1–361（361 aa） Chain Bs 1–361（361 aa） Chain Bt 1–361（361 aa） Chain Bu 1–361（361 aa） Chain Bv 1–361（361 aa） Chain Bw 1–361（361 aa） Chain Bx 1–361（361 aa） Chain By 1–361（361 aa） Chain Bz 1–361（361 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.57 Å
9YFG Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state Deposited 2025-09-25	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 298 PDB declaration: 298-meric	Chain Ba 19–361（343 aa） Chain Bb 19–361（343 aa） Chain Bc 19–361（343 aa） Chain Bd 19–361（343 aa） Chain Be 19–361（343 aa） Chain Bf 19–361（343 aa） Chain Bg 19–361（343 aa） Chain Bh 19–361（343 aa） Chain Bi 19–361（343 aa） Chain Bj 19–361（343 aa） Chain Bk 19–361（343 aa） Chain Bl 19–361（343 aa） Chain Bm 19–361（343 aa） Chain Bn 19–361（343 aa） Chain Bo 19–361（343 aa） Chain Bp 19–361（343 aa） Chain Bq 19–361（343 aa） Chain Br 19–361（343 aa） Chain Bs 19–361（343 aa） Chain Bt 19–361（343 aa） Chain Bu 19–361（343 aa） Chain Bv 19–361（343 aa） Chain Bw 19–361（343 aa） Chain Bx 19–361（343 aa） Chain By 19–361（343 aa） Chain Bz 19–361（343 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.55 Å
9YH0 LPHT-ring subunit with C13 MotX in Vibrio cholerae at assembled state Deposited 2025-09-29	Different oligomeric state	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Ba 19–361（343 aa） Chain Bb 19–361（343 aa） Chain Bc 19–361（343 aa） Chain Bd 19–361（343 aa） Chain Be 19–361（343 aa） Chain Bf 19–361（343 aa） Chain Bg 19–361（343 aa） Chain Bh 19–361（343 aa） Chain Bi 19–361（343 aa） Chain Bj 19–361（343 aa） Chain Bk 19–361（343 aa） Chain Bl 19–361（343 aa） Chain Bm 19–361（343 aa） Chain Bn 19–361（343 aa） Chain Bo 19–361（343 aa） Chain Bp 19–361（343 aa） Chain Bq 19–361（343 aa） Chain Br 19–361（343 aa） Chain Bs 19–361（343 aa） Chain Bt 19–361（343 aa） Chain Bu 19–361（343 aa） Chain Bv 19–361（343 aa） Chain Bw 19–361（343 aa） Chain Bx 19–361（343 aa） Chain By 19–361（343 aa） Chain Bz 19–361（343 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Cx 19–361（343 aa） Chain Cy 19–361（343 aa） Chain Cz 19–361（343 aa） Chain Da 19–361（343 aa） Chain Db 19–361（343 aa） Chain Dc 19–361（343 aa） Chain Dd 19–361（343 aa） Chain De 19–361（343 aa） Chain Df 19–361（343 aa） Chain Dg 19–361（343 aa） Chain Dh 19–361（343 aa） Chain Di 19–361（343 aa） Chain Dj 19–361（343 aa） Chain Dk 19–361（343 aa） Chain Dl 19–361（343 aa） Chain Dm 19–361（343 aa） Chain Dn 19–361（343 aa） Chain Do 19–361（343 aa） Chain Dp 19–361（343 aa） Chain Dq 19–361（343 aa） Chain Dr 19–361（343 aa） Chain Ds 19–361（343 aa） Chain Dt 19–361（343 aa） Chain Du 19–361（343 aa） Chain Dv 19–361（343 aa） Chain Dw 19–361（343 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGI_VIBCH
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain Cx； PDBConstruct 1–343； UniProt 19–361 Author chain Cy； PDBConstruct 1–343； UniProt 19–361 Author chain Cz； PDBConstruct 1–343； UniProt 19–361 Author chain Da； PDBConstruct 1–343； UniProt 19–361 Author chain Db； PDBConstruct 1–343； UniProt 19–361 Author chain Dc； PDBConstruct 1–343； UniProt 19–361 Author chain Dd； PDBConstruct 1–343； UniProt 19–361 Author chain De； PDBConstruct 1–343； UniProt 19–361 Author chain Df； PDBConstruct 1–343； UniProt 19–361 Author chain Dg； PDBConstruct 1–343； UniProt 19–361 Author chain Dh； PDBConstruct 1–343； UniProt 19–361 Author chain Di； PDBConstruct 1–343； UniProt 19–361 Author chain Dj； PDBConstruct 1–343； UniProt 19–361 Author chain Dk； PDBConstruct 1–343； UniProt 19–361 Author chain Dl； PDBConstruct 1–343； UniProt 19–361 Author chain Dm； PDBConstruct 1–343； UniProt 19–361 Author chain Dn； PDBConstruct 1–343； UniProt 19–361 Author chain Do； PDBConstruct 1–343； UniProt 19–361 Author chain Dp； PDBConstruct 1–343； UniProt 19–361 Author chain Dq； PDBConstruct 1–343； UniProt 19–361 Author chain Dr； PDBConstruct 1–343； UniProt 19–361 Author chain Ds； PDBConstruct 1–343； UniProt 19–361 Author chain Dt； PDBConstruct 1–343； UniProt 19–361 Author chain Du； PDBConstruct 1–343； UniProt 19–361 Author chain Dv； PDBConstruct 1–343； UniProt 19–361 Author chain Dw； PDBConstruct 1–343； UniProt 19–361

Flagellar protein FlgT

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KPZ9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 407 PDB declaration: 407-meric（407） Consistent with protein copy count	Chain Dx； UniProt 26–377 Chain Dy； UniProt 26–377 Chain Dz； UniProt 26–377 Chain Ea； UniProt 26–377 Chain Eb； UniProt 26–377 Chain Ec； UniProt 26–377 Chain Ed； UniProt 26–377 Chain Ee； UniProt 26–377 Chain Ef； UniProt 26–377 Chain Eg； UniProt 26–377 Chain Eh； UniProt 26–377 Chain Ei； UniProt 26–377 Chain Ej； UniProt 26–377 Chain Ek； UniProt 26–377 Chain El； UniProt 26–377 Chain Em； UniProt 26–377 Chain En； UniProt 26–377 Chain Eo； UniProt 26–377 Chain Ep； UniProt 26–377 Chain Eq； UniProt 26–377 Chain Er； UniProt 26–377 Chain Es； UniProt 26–377 Chain Et； UniProt 26–377 Chain Eu； UniProt 26–377 Chain Ev； UniProt 26–377 Chain Ew； UniProt 26–377	Not recorded	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YH7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YDO LPHT-ring in Vibrio cholerae at assembled, opened state Deposited 2025-09-22	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Ca 26–377（352 aa） Chain Cb 26–377（352 aa） Chain Cc 26–377（352 aa） Chain Cd 26–377（352 aa） Chain Ce 26–377（352 aa） Chain Cf 26–377（352 aa） Chain Cg 26–377（352 aa） Chain Ch 26–377（352 aa） Chain Ci 26–377（352 aa） Chain Cj 26–377（352 aa） Chain Ck 26–377（352 aa） Chain Cl 26–377（352 aa） Chain Cm 26–377（352 aa） Chain Cn 26–377（352 aa） Chain Co 26–377（352 aa） Chain Cp 26–377（352 aa） Chain Cq 26–377（352 aa） Chain Cr 26–377（352 aa） Chain Cs 26–377（352 aa） Chain Ct 26–377（352 aa） Chain Cu 26–377（352 aa） Chain Cv 26–377（352 aa） Chain Cw 26–377（352 aa） Chain Cx 26–377（352 aa） Chain Cy 26–377（352 aa） Chain Cz 26–377（352 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.69 Å
9YDT LPHT-ring in Vibrio cholerae at disassembled, closed state Deposited 2025-09-23	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Ca 26–377（352 aa） Chain Cb 26–377（352 aa） Chain Cc 26–377（352 aa） Chain Cd 26–377（352 aa） Chain Ce 26–377（352 aa） Chain Cf 26–377（352 aa） Chain Cg 26–377（352 aa） Chain Ch 26–377（352 aa） Chain Ci 26–377（352 aa） Chain Cj 26–377（352 aa） Chain Ck 26–377（352 aa） Chain Cl 26–377（352 aa） Chain Cm 26–377（352 aa） Chain Cn 26–377（352 aa） Chain Co 26–377（352 aa） Chain Cp 26–377（352 aa） Chain Cq 26–377（352 aa） Chain Cr 26–377（352 aa） Chain Cs 26–377（352 aa） Chain Ct 26–377（352 aa） Chain Cu 26–377（352 aa） Chain Cv 26–377（352 aa） Chain Cw 26–377（352 aa） Chain Cx 26–377（352 aa） Chain Cy 26–377（352 aa） Chain Cz 26–377（352 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.75 Å
9YEC LPHT-ring in Vibrio cholerae at disassembled, closed state Deposited 2025-09-24	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Ca 1–377（377 aa） Chain Cb 1–377（377 aa） Chain Cc 1–377（377 aa） Chain Cd 1–377（377 aa） Chain Ce 1–377（377 aa） Chain Cf 1–377（377 aa） Chain Cg 1–377（377 aa） Chain Ch 1–377（377 aa） Chain Ci 1–377（377 aa） Chain Cj 1–377（377 aa） Chain Ck 1–377（377 aa） Chain Cl 1–377（377 aa） Chain Cm 1–377（377 aa） Chain Cn 1–377（377 aa） Chain Co 1–377（377 aa） Chain Cp 1–377（377 aa） Chain Cq 1–377（377 aa） Chain Cr 1–377（377 aa） Chain Cs 1–377（377 aa） Chain Ct 1–377（377 aa） Chain Cu 1–377（377 aa） Chain Cv 1–377（377 aa） Chain Cw 1–377（377 aa） Chain Cx 1–377（377 aa） Chain Cy 1–377（377 aa） Chain Cz 1–377（377 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.57 Å
9YFG Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state Deposited 2025-09-25	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 298 PDB declaration: 298-meric	Chain Ca 26–377（352 aa） Chain Cb 26–377（352 aa） Chain Cc 26–377（352 aa） Chain Cd 26–377（352 aa） Chain Ce 26–377（352 aa） Chain Cf 26–377（352 aa） Chain Cg 26–377（352 aa） Chain Ch 26–377（352 aa） Chain Ci 26–377（352 aa） Chain Cj 26–377（352 aa） Chain Ck 26–377（352 aa） Chain Cl 26–377（352 aa） Chain Cm 26–377（352 aa） Chain Cn 26–377（352 aa） Chain Co 26–377（352 aa） Chain Cp 26–377（352 aa） Chain Cq 26–377（352 aa） Chain Cr 26–377（352 aa） Chain Cs 26–377（352 aa） Chain Ct 26–377（352 aa） Chain Cu 26–377（352 aa） Chain Cv 26–377（352 aa） Chain Cw 26–377（352 aa） Chain Cx 26–377（352 aa） Chain Cy 26–377（352 aa） Chain Cz 26–377（352 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.55 Å
9YH0 LPHT-ring subunit with C13 MotX in Vibrio cholerae at assembled state Deposited 2025-09-29	Different oligomeric state	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Ca 26–377（352 aa） Chain Cb 26–377（352 aa） Chain Cc 26–377（352 aa） Chain Cd 26–377（352 aa） Chain Ce 26–377（352 aa） Chain Cf 26–377（352 aa） Chain Cg 26–377（352 aa） Chain Ch 26–377（352 aa） Chain Ci 26–377（352 aa） Chain Cj 26–377（352 aa） Chain Ck 26–377（352 aa） Chain Cl 26–377（352 aa） Chain Cm 26–377（352 aa） Chain Cn 26–377（352 aa） Chain Co 26–377（352 aa） Chain Cp 26–377（352 aa） Chain Cq 26–377（352 aa） Chain Cr 26–377（352 aa） Chain Cs 26–377（352 aa） Chain Ct 26–377（352 aa） Chain Cu 26–377（352 aa） Chain Cv 26–377（352 aa） Chain Cw 26–377（352 aa） Chain Cx 26–377（352 aa） Chain Cy 26–377（352 aa） Chain Cz 26–377（352 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Dx 26–377（352 aa） Chain Dy 26–377（352 aa） Chain Dz 26–377（352 aa） Chain Ea 26–377（352 aa） Chain Eb 26–377（352 aa） Chain Ec 26–377（352 aa） Chain Ed 26–377（352 aa） Chain Ee 26–377（352 aa） Chain Ef 26–377（352 aa） Chain Eg 26–377（352 aa） Chain Eh 26–377（352 aa） Chain Ei 26–377（352 aa） Chain Ej 26–377（352 aa） Chain Ek 26–377（352 aa） Chain El 26–377（352 aa） Chain Em 26–377（352 aa） Chain En 26–377（352 aa） Chain Eo 26–377（352 aa） Chain Ep 26–377（352 aa） Chain Eq 26–377（352 aa） Chain Er 26–377（352 aa） Chain Es 26–377（352 aa） Chain Et 26–377（352 aa） Chain Eu 26–377（352 aa） Chain Ev 26–377（352 aa） Chain Ew 26–377（352 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9KPZ9_VIBCH
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain Dx； PDBConstruct 1–352； UniProt 26–377 Author chain Dy； PDBConstruct 1–352； UniProt 26–377 Author chain Dz； PDBConstruct 1–352； UniProt 26–377 Author chain Ea； PDBConstruct 1–352； UniProt 26–377 Author chain Eb； PDBConstruct 1–352； UniProt 26–377 Author chain Ec； PDBConstruct 1–352； UniProt 26–377 Author chain Ed； PDBConstruct 1–352； UniProt 26–377 Author chain Ee； PDBConstruct 1–352； UniProt 26–377 Author chain Ef； PDBConstruct 1–352； UniProt 26–377 Author chain Eg； PDBConstruct 1–352； UniProt 26–377 Author chain Eh； PDBConstruct 1–352； UniProt 26–377 Author chain Ei； PDBConstruct 1–352； UniProt 26–377 Author chain Ej； PDBConstruct 1–352； UniProt 26–377 Author chain Ek； PDBConstruct 1–352； UniProt 26–377 Author chain El； PDBConstruct 1–352； UniProt 26–377 Author chain Em； PDBConstruct 1–352； UniProt 26–377 Author chain En； PDBConstruct 1–352； UniProt 26–377 Author chain Eo； PDBConstruct 1–352； UniProt 26–377 Author chain Ep； PDBConstruct 1–352； UniProt 26–377 Author chain Eq； PDBConstruct 1–352； UniProt 26–377 Author chain Er； PDBConstruct 1–352； UniProt 26–377 Author chain Es； PDBConstruct 1–352； UniProt 26–377 Author chain Et； PDBConstruct 1–352； UniProt 26–377 Author chain Eu； PDBConstruct 1–352； UniProt 26–377 Author chain Ev； PDBConstruct 1–352； UniProt 26–377 Author chain Ew； PDBConstruct 1–352； UniProt 26–377

Sodium-type flagellar protein MotY

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KT95

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 407 PDB declaration: 407-meric（407） Consistent with protein copy count	Chain Ex； UniProt 23–293 Chain Ey； UniProt 23–293 Chain Ez； UniProt 23–293 Chain Fa； UniProt 23–293 Chain Fb； UniProt 23–293 Chain Fc； UniProt 23–293 Chain Fd； UniProt 23–293 Chain Fe； UniProt 23–293 Chain Ff； UniProt 23–293 Chain Fg； UniProt 23–293 Chain Fh； UniProt 23–293 Chain Fi； UniProt 23–293 Chain Fj； UniProt 23–293 Chain Fk； UniProt 23–293 Chain Fl； UniProt 23–293 Chain Fm； UniProt 23–293 Chain Fn； UniProt 23–293 Chain Fo； UniProt 23–293 Chain Fp； UniProt 23–293 Chain Fq； UniProt 23–293 Chain Fr； UniProt 23–293 Chain Fs； UniProt 23–293 Chain Ft； UniProt 23–293 Chain Fu； UniProt 23–293 Chain Fv； UniProt 23–293 Chain Fw； UniProt 23–293	Not recorded	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YH7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YDO LPHT-ring in Vibrio cholerae at assembled, opened state Deposited 2025-09-22	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Da 23–294（272 aa） Chain Db 23–294（272 aa） Chain Dc 23–294（272 aa） Chain Dd 23–294（272 aa） Chain De 23–294（272 aa） Chain Df 23–294（272 aa） Chain Dg 23–294（272 aa） Chain Dh 23–294（272 aa） Chain Di 23–294（272 aa） Chain Dj 23–294（272 aa） Chain Dk 23–294（272 aa） Chain Dl 23–294（272 aa） Chain Dm 23–294（272 aa） Chain Dn 23–294（272 aa） Chain Do 23–294（272 aa） Chain Dp 23–294（272 aa） Chain Dq 23–294（272 aa） Chain Dr 23–294（272 aa） Chain Ds 23–294（272 aa） Chain Dt 23–294（272 aa） Chain Du 23–294（272 aa） Chain Dv 23–294（272 aa） Chain Dw 23–294（272 aa） Chain Dx 23–294（272 aa） Chain Dy 23–294（272 aa） Chain Dz 23–294（272 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.69 Å
9YDT LPHT-ring in Vibrio cholerae at disassembled, closed state Deposited 2025-09-23	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Da 23–294（272 aa） Chain Db 23–294（272 aa） Chain Dc 23–294（272 aa） Chain Dd 23–294（272 aa） Chain De 23–294（272 aa） Chain Df 23–294（272 aa） Chain Dg 23–294（272 aa） Chain Dh 23–294（272 aa） Chain Di 23–294（272 aa） Chain Dj 23–294（272 aa） Chain Dk 23–294（272 aa） Chain Dl 23–294（272 aa） Chain Dm 23–294（272 aa） Chain Dn 23–294（272 aa） Chain Do 23–294（272 aa） Chain Dp 23–294（272 aa） Chain Dq 23–294（272 aa） Chain Dr 23–294（272 aa） Chain Ds 23–294（272 aa） Chain Dt 23–294（272 aa） Chain Du 23–294（272 aa） Chain Dv 23–294（272 aa） Chain Dw 23–294（272 aa） Chain Dx 23–294（272 aa） Chain Dy 23–294（272 aa） Chain Dz 23–294（272 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.75 Å
9YEC LPHT-ring in Vibrio cholerae at disassembled, closed state Deposited 2025-09-24	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Da 1–294（294 aa） Chain Db 1–294（294 aa） Chain Dc 1–294（294 aa） Chain Dd 1–294（294 aa） Chain De 1–294（294 aa） Chain Df 1–294（294 aa） Chain Dg 1–294（294 aa） Chain Dh 1–294（294 aa） Chain Di 1–294（294 aa） Chain Dj 1–294（294 aa） Chain Dk 1–294（294 aa） Chain Dl 1–294（294 aa） Chain Dm 1–294（294 aa） Chain Dn 1–294（294 aa） Chain Do 1–294（294 aa） Chain Dp 1–294（294 aa） Chain Dq 1–294（294 aa） Chain Dr 1–294（294 aa） Chain Ds 1–294（294 aa） Chain Dt 1–294（294 aa） Chain Du 1–294（294 aa） Chain Dv 1–294（294 aa） Chain Dw 1–294（294 aa） Chain Dx 1–294（294 aa） Chain Dy 1–294（294 aa） Chain Dz 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.57 Å
9YED T-ring-PomB complex in Vibrio cholerae Deposited 2025-09-24	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain BP1 23–294（272 aa） Chain FP1 23–294（272 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 4.98 Å
9YFG Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state Deposited 2025-09-25	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 298 PDB declaration: 298-meric	Chain Da 23–293（271 aa） Chain Db 23–293（271 aa） Chain Dc 23–293（271 aa） Chain Dd 23–293（271 aa） Chain De 23–293（271 aa） Chain Df 23–293（271 aa） Chain Dg 23–293（271 aa） Chain Dh 23–293（271 aa） Chain Di 23–293（271 aa） Chain Dj 23–293（271 aa） Chain Dk 23–293（271 aa） Chain Dl 23–293（271 aa） Chain Dm 23–293（271 aa） Chain Dn 23–293（271 aa） Chain Do 23–293（271 aa） Chain Dp 23–293（271 aa） Chain Dq 23–293（271 aa） Chain Dr 23–293（271 aa） Chain Ds 23–293（271 aa） Chain Dt 23–293（271 aa） Chain Du 23–293（271 aa） Chain Dv 23–293（271 aa） Chain Dw 23–293（271 aa） Chain Dx 23–293（271 aa） Chain Dy 23–293（271 aa） Chain Dz 23–293（271 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.55 Å
9YH0 LPHT-ring subunit with C13 MotX in Vibrio cholerae at assembled state Deposited 2025-09-29	Different construct Different oligomeric state	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Da 23–294（272 aa） Chain Db 23–294（272 aa） Chain Dc 23–294（272 aa） Chain Dd 23–294（272 aa） Chain De 23–294（272 aa） Chain Df 23–294（272 aa） Chain Dg 23–294（272 aa） Chain Dh 23–294（272 aa） Chain Di 23–294（272 aa） Chain Dj 23–294（272 aa） Chain Dk 23–294（272 aa） Chain Dl 23–294（272 aa） Chain Dm 23–294（272 aa） Chain Dn 23–294（272 aa） Chain Do 23–294（272 aa） Chain Dp 23–294（272 aa） Chain Dq 23–294（272 aa） Chain Dr 23–294（272 aa） Chain Ds 23–294（272 aa） Chain Dt 23–294（272 aa） Chain Du 23–294（272 aa） Chain Dv 23–294（272 aa） Chain Dw 23–294（272 aa） Chain Dx 23–294（272 aa） Chain Dy 23–294（272 aa） Chain Dz 23–294（272 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Ex 23–293（271 aa） Chain Ey 23–293（271 aa） Chain Ez 23–293（271 aa） Chain Fa 23–293（271 aa） Chain Fb 23–293（271 aa） Chain Fc 23–293（271 aa） Chain Fd 23–293（271 aa） Chain Fe 23–293（271 aa） Chain Ff 23–293（271 aa） Chain Fg 23–293（271 aa） Chain Fh 23–293（271 aa） Chain Fi 23–293（271 aa） Chain Fj 23–293（271 aa） Chain Fk 23–293（271 aa） Chain Fl 23–293（271 aa） Chain Fm 23–293（271 aa） Chain Fn 23–293（271 aa） Chain Fo 23–293（271 aa） Chain Fp 23–293（271 aa） Chain Fq 23–293（271 aa） Chain Fr 23–293（271 aa） Chain Fs 23–293（271 aa） Chain Ft 23–293（271 aa） Chain Fu 23–293（271 aa） Chain Fv 23–293（271 aa） Chain Fw 23–293（271 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9KT95_VIBCH
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Ex； PDBConstruct 1–271； UniProt 23–293 Author chain Ey； PDBConstruct 1–271； UniProt 23–293 Author chain Ez； PDBConstruct 1–271； UniProt 23–293 Author chain Fa； PDBConstruct 1–271； UniProt 23–293 Author chain Fb； PDBConstruct 1–271； UniProt 23–293 Author chain Fc； PDBConstruct 1–271； UniProt 23–293 Author chain Fd； PDBConstruct 1–271； UniProt 23–293 Author chain Fe； PDBConstruct 1–271； UniProt 23–293 Author chain Ff； PDBConstruct 1–271； UniProt 23–293 Author chain Fg； PDBConstruct 1–271； UniProt 23–293 Author chain Fh； PDBConstruct 1–271； UniProt 23–293 Author chain Fi； PDBConstruct 1–271； UniProt 23–293 Author chain Fj； PDBConstruct 1–271； UniProt 23–293 Author chain Fk； PDBConstruct 1–271； UniProt 23–293 Author chain Fl； PDBConstruct 1–271； UniProt 23–293 Author chain Fm； PDBConstruct 1–271； UniProt 23–293 Author chain Fn； PDBConstruct 1–271； UniProt 23–293 Author chain Fo； PDBConstruct 1–271； UniProt 23–293 Author chain Fp； PDBConstruct 1–271； UniProt 23–293 Author chain Fq； PDBConstruct 1–271； UniProt 23–293 Author chain Fr； PDBConstruct 1–271； UniProt 23–293 Author chain Fs； PDBConstruct 1–271； UniProt 23–293 Author chain Ft； PDBConstruct 1–271； UniProt 23–293 Author chain Fu； PDBConstruct 1–271； UniProt 23–293 Author chain Fv； PDBConstruct 1–271； UniProt 23–293 Author chain Fw； PDBConstruct 1–271； UniProt 23–293

Sodium-type flagellar protein MotX

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KNX9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 407 PDB declaration: 407-meric（407） Consistent with protein copy count	Chain Fx； UniProt 29–211 Chain Fy； UniProt 29–211 Chain Fz； UniProt 29–211 Chain Ga； UniProt 29–211 Chain Gb； UniProt 29–211 Chain Gc； UniProt 29–211 Chain Gd； UniProt 29–211 Chain Ge； UniProt 29–211 Chain Gf； UniProt 29–211 Chain Gg； UniProt 29–211 Chain Gh； UniProt 29–211 Chain Gi； UniProt 29–211 Chain Gj； UniProt 29–211 Chain Gk； UniProt 29–211 Chain Gl； UniProt 29–211 Chain Gm； UniProt 29–211 Chain Gn； UniProt 29–211 Chain Go； UniProt 29–211 Chain Gp； UniProt 29–211 Chain Gq； UniProt 29–211 Chain Gr； UniProt 29–211 Chain Gs； UniProt 29–211 Chain Gt； UniProt 29–211 Chain Gu； UniProt 29–211 Chain Gv； UniProt 29–211 Chain Gw； UniProt 29–211	Not recorded	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YH7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YEC LPHT-ring in Vibrio cholerae at disassembled, closed state Deposited 2025-09-24	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Ea 1–211（211 aa） Chain Eb 1–211（211 aa） Chain Ec 1–211（211 aa） Chain Ed 1–211（211 aa） Chain Ee 1–211（211 aa） Chain Ef 1–211（211 aa） Chain Eg 1–211（211 aa） Chain Eh 1–211（211 aa） Chain Ei 1–211（211 aa） Chain Ej 1–211（211 aa） Chain Ek 1–211（211 aa） Chain El 1–211（211 aa） Chain Em 1–211（211 aa） Chain En 1–211（211 aa） Chain Eo 1–211（211 aa） Chain Ep 1–211（211 aa） Chain Eq 1–211（211 aa） Chain Er 1–211（211 aa） Chain Es 1–211（211 aa） Chain Et 1–211（211 aa） Chain Eu 1–211（211 aa） Chain Ev 1–211（211 aa） Chain Ew 1–211（211 aa） Chain Ex 1–211（211 aa） Chain Ey 1–211（211 aa） Chain Ez 1–211（211 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.57 Å
9YED T-ring-PomB complex in Vibrio cholerae Deposited 2025-09-24	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain AP1 24–211（188 aa） Chain EP1 24–211（188 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 4.98 Å
9YFG Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state Deposited 2025-09-25	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 298 PDB declaration: 298-meric	Chain Ea 29–211（183 aa） Chain Eb 29–211（183 aa） Chain Ec 29–211（183 aa） Chain Ed 29–211（183 aa） Chain Ee 29–211（183 aa） Chain Ef 29–211（183 aa） Chain Eg 29–211（183 aa） Chain Eh 29–211（183 aa） Chain Ei 29–211（183 aa） Chain Ej 29–211（183 aa） Chain Ek 29–211（183 aa） Chain El 29–211（183 aa） Chain Em 29–211（183 aa） Chain En 29–211（183 aa） Chain Eo 29–211（183 aa） Chain Ep 29–211（183 aa） Chain Eq 29–211（183 aa） Chain Er 29–211（183 aa） Chain Es 29–211（183 aa） Chain Et 29–211（183 aa） Chain Eu 29–211（183 aa） Chain Ev 29–211（183 aa） Chain Ew 29–211（183 aa） Chain Ex 29–211（183 aa） Chain Ey 29–211（183 aa） Chain Ez 29–211（183 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.55 Å
9YH0 LPHT-ring subunit with C13 MotX in Vibrio cholerae at assembled state Deposited 2025-09-29	Different construct Different oligomeric state	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Ea 24–211（188 aa） Chain Eb 24–211（188 aa） Chain Ec 24–211（188 aa） Chain Ed 24–211（188 aa） Chain Ee 24–211（188 aa） Chain Ef 24–211（188 aa） Chain Eg 24–211（188 aa） Chain Eh 24–211（188 aa） Chain Ei 24–211（188 aa） Chain Ej 24–211（188 aa） Chain Ek 24–211（188 aa） Chain El 24–211（188 aa） Chain Em 24–211（188 aa） Chain En 24–211（188 aa） Chain Eo 24–211（188 aa） Chain Ep 24–211（188 aa） Chain Eq 24–211（188 aa） Chain Er 24–211（188 aa） Chain Es 24–211（188 aa） Chain Et 24–211（188 aa） Chain Eu 24–211（188 aa） Chain Ev 24–211（188 aa） Chain Ew 24–211（188 aa） Chain Ex 24–211（188 aa） Chain Ey 24–211（188 aa） Chain Ez 24–211（188 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Fx 29–211（183 aa） Chain Fy 29–211（183 aa） Chain Fz 29–211（183 aa） Chain Ga 29–211（183 aa） Chain Gb 29–211（183 aa） Chain Gc 29–211（183 aa） Chain Gd 29–211（183 aa） Chain Ge 29–211（183 aa） Chain Gf 29–211（183 aa） Chain Gg 29–211（183 aa） Chain Gh 29–211（183 aa） Chain Gi 29–211（183 aa） Chain Gj 29–211（183 aa） Chain Gk 29–211（183 aa） Chain Gl 29–211（183 aa） Chain Gm 29–211（183 aa） Chain Gn 29–211（183 aa） Chain Go 29–211（183 aa） Chain Gp 29–211（183 aa） Chain Gq 29–211（183 aa） Chain Gr 29–211（183 aa） Chain Gs 29–211（183 aa） Chain Gt 29–211（183 aa） Chain Gu 29–211（183 aa） Chain Gv 29–211（183 aa） Chain Gw 29–211（183 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9KNX9_VIBCH
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Fx； PDBConstruct 1–183； UniProt 29–211 Author chain Fy； PDBConstruct 1–183； UniProt 29–211 Author chain Fz； PDBConstruct 1–183； UniProt 29–211 Author chain Ga； PDBConstruct 1–183； UniProt 29–211 Author chain Gb； PDBConstruct 1–183； UniProt 29–211 Author chain Gc； PDBConstruct 1–183； UniProt 29–211 Author chain Gd； PDBConstruct 1–183； UniProt 29–211 Author chain Ge； PDBConstruct 1–183； UniProt 29–211 Author chain Gf； PDBConstruct 1–183； UniProt 29–211 Author chain Gg； PDBConstruct 1–183； UniProt 29–211 Author chain Gh； PDBConstruct 1–183； UniProt 29–211 Author chain Gi； PDBConstruct 1–183； UniProt 29–211 Author chain Gj； PDBConstruct 1–183； UniProt 29–211 Author chain Gk； PDBConstruct 1–183； UniProt 29–211 Author chain Gl； PDBConstruct 1–183； UniProt 29–211 Author chain Gm； PDBConstruct 1–183； UniProt 29–211 Author chain Gn； PDBConstruct 1–183； UniProt 29–211 Author chain Go； PDBConstruct 1–183； UniProt 29–211 Author chain Gp； PDBConstruct 1–183； UniProt 29–211 Author chain Gq； PDBConstruct 1–183； UniProt 29–211 Author chain Gr； PDBConstruct 1–183； UniProt 29–211 Author chain Gs； PDBConstruct 1–183； UniProt 29–211 Author chain Gt； PDBConstruct 1–183； UniProt 29–211 Author chain Gu； PDBConstruct 1–183； UniProt 29–211 Author chain Gv； PDBConstruct 1–183； UniProt 29–211 Author chain Gw； PDBConstruct 1–183； UniProt 29–211

FlgP

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ01

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 407 PDB declaration: 407-meric（407） Consistent with protein copy count	Chain Gx； UniProt 134–145 Chain Gy； UniProt 134–145 Chain Gz； UniProt 134–145 Chain Ha； UniProt 134–145 Chain Hb； UniProt 134–145 Chain Hc； UniProt 134–145 Chain Hd； UniProt 134–145 Chain He； UniProt 134–145 Chain Hf； UniProt 134–145 Chain Hg； UniProt 134–145 Chain Hh； UniProt 134–145 Chain Hi； UniProt 134–145 Chain Hj； UniProt 134–145 Chain Hk； UniProt 134–145 Chain Hl； UniProt 134–145 Chain Hm； UniProt 134–145 Chain Hn； UniProt 134–145 Chain Ho； UniProt 134–145 Chain Hp； UniProt 134–145 Chain Hq； UniProt 134–145 Chain Hr； UniProt 134–145 Chain Hs； UniProt 134–145 Chain Ht； UniProt 134–145 Chain Hu； UniProt 134–145 Chain Hv； UniProt 134–145 Chain Hw； UniProt 134–145 Chain Hx； UniProt 134–145 Chain Hy； UniProt 134–145 Chain Hz； UniProt 134–145 Chain Ia； UniProt 134–145 Chain Ib； UniProt 134–145 Chain Ic； UniProt 134–145 Chain Id； UniProt 134–145 Chain Ie； UniProt 134–145 Chain If； UniProt 134–145 Chain Ig； UniProt 134–145 Chain Ih； UniProt 134–145 Chain Ii； UniProt 134–145 Chain Ij； UniProt 134–145 Chain Ik； UniProt 134–145 Chain Il； UniProt 134–145 Chain Im； UniProt 134–145 Chain In； UniProt 134–145 Chain Io； UniProt 134–145 Chain Ip； UniProt 134–145 Chain Iq； UniProt 134–145 Chain Ir； UniProt 134–145 Chain Is； UniProt 134–145 Chain It； UniProt 134–145 Chain Iu； UniProt 134–145 Chain Iv； UniProt 134–145 Chain Iw； UniProt 134–145 Chain Jx； UniProt 26–130 Chain Jy； UniProt 26–130 Chain Jz； UniProt 26–130 Chain Ka； UniProt 26–130 Chain Kb； UniProt 26–130 Chain Kc； UniProt 26–130 Chain Kd； UniProt 26–130 Chain Ke； UniProt 26–130 Chain Kf； UniProt 26–130 Chain Kg； UniProt 26–130 Chain Kh； UniProt 26–130 Chain Ki； UniProt 26–130 Chain Kj； UniProt 26–130 Chain Kk； UniProt 26–130 Chain Kl； UniProt 26–130 Chain Km； UniProt 26–130 Chain Kn； UniProt 26–130 Chain Ko； UniProt 26–130 Chain Kp； UniProt 26–130 Chain Kq； UniProt 26–130 Chain Kr； UniProt 26–130 Chain Ks； UniProt 26–130 Chain Kt； UniProt 26–130 Chain Ku； UniProt 26–130 Chain Kv； UniProt 26–130 Chain Kw； UniProt 26–130 Chain Kx； UniProt 26–130 Chain Ky； UniProt 26–130 Chain Kz； UniProt 26–130 Chain La； UniProt 26–130 Chain Lb； UniProt 26–130 Chain Lc； UniProt 26–130 Chain Ld； UniProt 26–130 Chain Le； UniProt 26–130 Chain Lf； UniProt 26–130 Chain Lg； UniProt 26–130 Chain Lh； UniProt 26–130 Chain Li； UniProt 26–130 Chain Lj； UniProt 26–130 Chain Lk； UniProt 26–130 Chain Ll； UniProt 26–130 Chain Lm； UniProt 26–130 Chain Ln； UniProt 26–130 Chain Lo； UniProt 26–130 Chain Lp； UniProt 26–130 Chain Lq； UniProt 26–130 Chain Lr； UniProt 26–130 Chain Ls； UniProt 26–130 Chain Lt； UniProt 26–130 Chain Lu； UniProt 26–130 Chain Lv； UniProt 26–130 Chain Lw； UniProt 26–130 Chain Lx； UniProt 26–130 Chain Ly； UniProt 26–130 Chain Lz； UniProt 26–130 Chain Ma； UniProt 26–130 Chain Mb； UniProt 26–130 Chain Mc； UniProt 26–130	Not recorded	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） Chemotaxis protein PomB × 26 （Q9KTK9） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YH7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YDS H-ring subunit FlgO and FlgP in Vibrio cholerae at assembled, opened state Deposited 2025-09-23	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 116 PDB declaration: 116-meric	Chain Aa 26–130（105 aa） Chain Ac 26–130（105 aa） Chain Ae 26–130（105 aa） Chain Ag 26–130（105 aa） Chain Ai 26–130（105 aa） Chain Ak 26–130（105 aa） Chain Am 26–130（105 aa） Chain Ao 26–130（105 aa） Chain Aq 26–130（105 aa） Chain As 26–130（105 aa） Chain Au 26–130（105 aa） Chain Aw 26–130（105 aa） Chain Ay 26–130（105 aa） Chain Ba 26–130（105 aa） Chain Bc 26–130（105 aa） Chain Be 26–130（105 aa） Chain Bg 26–130（105 aa） Chain Bi 26–130（105 aa） Chain Bk 26–130（105 aa） Chain Bm 26–130（105 aa） Chain Bo 26–130（105 aa） Chain Bq 26–130（105 aa） Chain Bs 26–130（105 aa） Chain Bu 26–130（105 aa） Chain Bw 26–130（105 aa） Chain By 26–130（105 aa） Chain Ca 26–130（105 aa） Chain Cc 26–130（105 aa） Chain Ce 26–130（105 aa） Chain Cg 26–130（105 aa） Chain Ci 26–130（105 aa） Chain Ck 26–130（105 aa） Chain Cm 26–130（105 aa） Chain Co 26–130（105 aa） Chain Cq 26–130（105 aa） Chain Cs 26–130（105 aa） Chain Cu 26–130（105 aa） Chain Cw 26–130（105 aa） Chain Cy 26–130（105 aa） Chain Da 26–130（105 aa） Chain Dc 26–130（105 aa） Chain De 26–130（105 aa） Chain Dg 26–130（105 aa） Chain Di 26–130（105 aa） Chain Dk 26–130（105 aa） Chain Dm 26–130（105 aa） Chain Do 26–130（105 aa） Chain Dq 26–130（105 aa） Chain Ds 26–130（105 aa） Chain Du 26–130（105 aa） Chain Dw 26–130（105 aa） Chain Dy 26–130（105 aa） Chain Ea 26–130（105 aa） Chain Ec 26–130（105 aa） Chain Ee 26–130（105 aa） Chain Eg 26–130（105 aa） Chain Ei 26–130（105 aa） Chain Ek 26–130（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.45 Å
9YEC LPHT-ring in Vibrio cholerae at disassembled, closed state Deposited 2025-09-24	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Fa 1–145（145 aa） Chain Fb 1–145（145 aa） Chain Fc 1–145（145 aa） Chain Fd 1–145（145 aa） Chain Fe 1–145（145 aa） Chain Ff 1–145（145 aa） Chain Fg 1–145（145 aa） Chain Fh 1–145（145 aa） Chain Fi 1–145（145 aa） Chain Fj 1–145（145 aa） Chain Fk 1–145（145 aa） Chain Fl 1–145（145 aa） Chain Fm 1–145（145 aa） Chain Fn 1–145（145 aa） Chain Fo 1–145（145 aa） Chain Fp 1–145（145 aa） Chain Fq 1–145（145 aa） Chain Fr 1–145（145 aa） Chain Fs 1–145（145 aa） Chain Ft 1–145（145 aa） Chain Fu 1–145（145 aa） Chain Fv 1–145（145 aa） Chain Fw 1–145（145 aa） Chain Fx 1–145（145 aa） Chain Fy 1–145（145 aa） Chain Fz 1–145（145 aa） Chain Ga 1–145（145 aa） Chain Gb 1–145（145 aa） Chain Gc 1–145（145 aa） Chain Gd 1–145（145 aa） Chain Ge 1–145（145 aa） Chain Gf 1–145（145 aa） Chain Gg 1–145（145 aa） Chain Gh 1–145（145 aa） Chain Gi 1–145（145 aa） Chain Gj 1–145（145 aa） Chain Gk 1–145（145 aa） Chain Gl 1–145（145 aa） Chain Gm 1–145（145 aa） Chain Gn 1–145（145 aa） Chain Go 1–145（145 aa） Chain Gp 1–145（145 aa） Chain Gq 1–145（145 aa） Chain Gr 1–145（145 aa） Chain Gs 1–145（145 aa） Chain Gt 1–145（145 aa） Chain Gu 1–145（145 aa） Chain Gv 1–145（145 aa） Chain Gw 1–145（145 aa） Chain Gx 1–145（145 aa） Chain Gy 1–145（145 aa） Chain Gz 1–145（145 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.57 Å
9YFG Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state Deposited 2025-09-25	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 298 PDB declaration: 298-meric	Chain Ha 26–130（105 aa） Chain Hc 26–130（105 aa） Chain He 26–130（105 aa） Chain Hg 26–130（105 aa） Chain Hi 26–130（105 aa） Chain Hk 26–130（105 aa） Chain Hm 26–130（105 aa） Chain Ho 26–130（105 aa） Chain Hq 26–130（105 aa） Chain Hs 26–130（105 aa） Chain Hu 26–130（105 aa） Chain Hw 26–130（105 aa） Chain Hy 26–130（105 aa） Chain Ia 26–130（105 aa） Chain Ic 26–130（105 aa） Chain Ie 26–130（105 aa） Chain Ig 26–130（105 aa） Chain Ii 26–130（105 aa） Chain Ik 26–130（105 aa） Chain Im 26–130（105 aa） Chain Io 26–130（105 aa） Chain Iq 26–130（105 aa） Chain Is 26–130（105 aa） Chain Iu 26–130（105 aa） Chain Iw 26–130（105 aa） Chain Iy 26–130（105 aa） Chain Ja 26–130（105 aa） Chain Jc 26–130（105 aa） Chain Je 26–130（105 aa） Chain Jg 26–130（105 aa） Chain Ji 26–130（105 aa） Chain Jk 26–130（105 aa） Chain Jm 26–130（105 aa） Chain Jo 26–130（105 aa） Chain Jq 26–130（105 aa） Chain Js 26–130（105 aa） Chain Ju 26–130（105 aa） Chain Jw 26–130（105 aa） Chain Jy 26–130（105 aa） Chain Ka 26–130（105 aa） Chain Kc 26–130（105 aa） Chain Ke 26–130（105 aa） Chain Kg 26–130（105 aa） Chain Ki 26–130（105 aa） Chain Kk 26–130（105 aa） Chain Km 26–130（105 aa） Chain Ko 26–130（105 aa） Chain Kq 26–130（105 aa） Chain Ks 26–130（105 aa） Chain Ku 26–130（105 aa） Chain Kw 26–130（105 aa） Chain Ky 26–130（105 aa） Chain La 26–130（105 aa） Chain Lc 26–130（105 aa） Chain Le 26–130（105 aa） Chain Lg 26–130（105 aa） Chain Li 26–130（105 aa） Chain Lk 26–130（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.55 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Different construct Different mutation/modification	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Jx 26–130（105 aa） Chain Jy 26–130（105 aa） Chain Jz 26–130（105 aa） Chain Ka 26–130（105 aa） Chain Kb 26–130（105 aa） Chain Kc 26–130（105 aa） Chain Kd 26–130（105 aa） Chain Ke 26–130（105 aa） Chain Kf 26–130（105 aa） Chain Kg 26–130（105 aa） Chain Kh 26–130（105 aa） Chain Ki 26–130（105 aa） Chain Kj 26–130（105 aa） Chain Kk 26–130（105 aa） Chain Kl 26–130（105 aa） Chain Km 26–130（105 aa） Chain Kn 26–130（105 aa） Chain Ko 26–130（105 aa） Chain Kp 26–130（105 aa） Chain Kq 26–130（105 aa） Chain Kr 26–130（105 aa） Chain Ks 26–130（105 aa） Chain Kt 26–130（105 aa） Chain Ku 26–130（105 aa） Chain Kv 26–130（105 aa） Chain Kw 26–130（105 aa） Chain Kx 26–130（105 aa） Chain Ky 26–130（105 aa） Chain Kz 26–130（105 aa） Chain La 26–130（105 aa） Chain Lb 26–130（105 aa） Chain Lc 26–130（105 aa） Chain Ld 26–130（105 aa） Chain Le 26–130（105 aa） Chain Lf 26–130（105 aa） Chain Lg 26–130（105 aa） Chain Lh 26–130（105 aa） Chain Li 26–130（105 aa） Chain Lj 26–130（105 aa） Chain Lk 26–130（105 aa） Chain Ll 26–130（105 aa） Chain Lm 26–130（105 aa） Chain Ln 26–130（105 aa） Chain Lo 26–130（105 aa） Chain Lp 26–130（105 aa） Chain Lq 26–130（105 aa） Chain Lr 26–130（105 aa） Chain Ls 26–130（105 aa） Chain Lt 26–130（105 aa） Chain Lu 26–130（105 aa） Chain Lv 26–130（105 aa） Chain Lw 26–130（105 aa） Chain Lx 26–130（105 aa） Chain Ly 26–130（105 aa） Chain Lz 26–130（105 aa） Chain Ma 26–130（105 aa） Chain Mb 26–130（105 aa） Chain Mc 26–130（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9KQ01_VIBCH
Isoform	—
PDB entities	9, 11
Chains and sequence ranges	Author chain Gx； PDBConstruct 1–12； UniProt 134–145 Author chain Gy； PDBConstruct 1–12； UniProt 134–145 Author chain Gz； PDBConstruct 1–12； UniProt 134–145 Author chain Ha； PDBConstruct 1–12； UniProt 134–145 Author chain Hb； PDBConstruct 1–12； UniProt 134–145 Author chain Hc； PDBConstruct 1–12； UniProt 134–145 Author chain Hd； PDBConstruct 1–12； UniProt 134–145 Author chain He； PDBConstruct 1–12； UniProt 134–145 Author chain Hf； PDBConstruct 1–12； UniProt 134–145 Author chain Hg； PDBConstruct 1–12； UniProt 134–145 Author chain Hh； PDBConstruct 1–12； UniProt 134–145 Author chain Hi； PDBConstruct 1–12； UniProt 134–145 Author chain Hj； PDBConstruct 1–12； UniProt 134–145 Author chain Hk； PDBConstruct 1–12； UniProt 134–145 Author chain Hl； PDBConstruct 1–12； UniProt 134–145 Author chain Hm； PDBConstruct 1–12； UniProt 134–145 Author chain Hn； PDBConstruct 1–12； UniProt 134–145 Author chain Ho； PDBConstruct 1–12； UniProt 134–145 Author chain Hp； PDBConstruct 1–12； UniProt 134–145 Author chain Hq； PDBConstruct 1–12； UniProt 134–145 Author chain Hr； PDBConstruct 1–12； UniProt 134–145 Author chain Hs； PDBConstruct 1–12； UniProt 134–145 Author chain Ht； PDBConstruct 1–12； UniProt 134–145 Author chain Hu； PDBConstruct 1–12； UniProt 134–145 Author chain Hv； PDBConstruct 1–12； UniProt 134–145 Author chain Hw； PDBConstruct 1–12； UniProt 134–145 Author chain Hx； PDBConstruct 1–12； UniProt 134–145 Author chain Hy； PDBConstruct 1–12； UniProt 134–145 Author chain Hz； PDBConstruct 1–12； UniProt 134–145 Author chain Ia； PDBConstruct 1–12； UniProt 134–145 Author chain Ib； PDBConstruct 1–12； UniProt 134–145 Author chain Ic； PDBConstruct 1–12； UniProt 134–145 Author chain Id； PDBConstruct 1–12； UniProt 134–145 Author chain Ie； PDBConstruct 1–12； UniProt 134–145 Author chain If； PDBConstruct 1–12； UniProt 134–145 Author chain Ig； PDBConstruct 1–12； UniProt 134–145 Author chain Ih； PDBConstruct 1–12； UniProt 134–145 Author chain Ii； PDBConstruct 1–12； UniProt 134–145 Author chain Ij； PDBConstruct 1–12； UniProt 134–145 Author chain Ik； PDBConstruct 1–12； UniProt 134–145 Author chain Il； PDBConstruct 1–12； UniProt 134–145 Author chain Im； PDBConstruct 1–12； UniProt 134–145 Author chain In； PDBConstruct 1–12； UniProt 134–145 Author chain Io； PDBConstruct 1–12； UniProt 134–145 Author chain Ip； PDBConstruct 1–12； UniProt 134–145 Author chain Iq； PDBConstruct 1–12； UniProt 134–145 Author chain Ir； PDBConstruct 1–12； UniProt 134–145 Author chain Is； PDBConstruct 1–12； UniProt 134–145 Author chain It； PDBConstruct 1–12； UniProt 134–145 Author chain Iu； PDBConstruct 1–12； UniProt 134–145 Author chain Iv； PDBConstruct 1–12； UniProt 134–145 Author chain Iw； PDBConstruct 1–12； UniProt 134–145 Author chain Jx； PDBConstruct 1–104； UniProt 26–130 Author chain Jy； PDBConstruct 1–104； UniProt 26–130 Author chain Jz； PDBConstruct 1–104； UniProt 26–130 Author chain Ka； PDBConstruct 1–104； UniProt 26–130 Author chain Kb； PDBConstruct 1–104； UniProt 26–130 Author chain Kc； PDBConstruct 1–104； UniProt 26–130 Author chain Kd； PDBConstruct 1–104； UniProt 26–130 Author chain Ke； PDBConstruct 1–104； UniProt 26–130 Author chain Kf； PDBConstruct 1–104； UniProt 26–130 Author chain Kg； PDBConstruct 1–104； UniProt 26–130 Author chain Kh； PDBConstruct 1–104； UniProt 26–130 Author chain Ki； PDBConstruct 1–104； UniProt 26–130 Author chain Kj； PDBConstruct 1–104； UniProt 26–130 Author chain Kk； PDBConstruct 1–104； UniProt 26–130 Author chain Kl； PDBConstruct 1–104； UniProt 26–130 Author chain Km； PDBConstruct 1–104； UniProt 26–130 Author chain Kn； PDBConstruct 1–104； UniProt 26–130 Author chain Ko； PDBConstruct 1–104； UniProt 26–130 Author chain Kp； PDBConstruct 1–104； UniProt 26–130 Author chain Kq； PDBConstruct 1–104； UniProt 26–130 Author chain Kr； PDBConstruct 1–104； UniProt 26–130 Author chain Ks； PDBConstruct 1–104； UniProt 26–130 Author chain Kt； PDBConstruct 1–104； UniProt 26–130 Author chain Ku； PDBConstruct 1–104； UniProt 26–130 Author chain Kv； PDBConstruct 1–104； UniProt 26–130 Author chain Kw； PDBConstruct 1–104； UniProt 26–130 Author chain Kx； PDBConstruct 1–104； UniProt 26–130 Author chain Ky； PDBConstruct 1–104； UniProt 26–130 Author chain Kz； PDBConstruct 1–104； UniProt 26–130 Author chain La； PDBConstruct 1–104； UniProt 26–130 Author chain Lb； PDBConstruct 1–104； UniProt 26–130 Author chain Lc； PDBConstruct 1–104； UniProt 26–130 Author chain Ld； PDBConstruct 1–104； UniProt 26–130 Author chain Le； PDBConstruct 1–104； UniProt 26–130 Author chain Lf； PDBConstruct 1–104； UniProt 26–130 Author chain Lg； PDBConstruct 1–104； UniProt 26–130 Author chain Lh； PDBConstruct 1–104； UniProt 26–130 Author chain Li； PDBConstruct 1–104； UniProt 26–130 Author chain Lj； PDBConstruct 1–104； UniProt 26–130 Author chain Lk； PDBConstruct 1–104； UniProt 26–130 Author chain Ll； PDBConstruct 1–104； UniProt 26–130 Author chain Lm； PDBConstruct 1–104； UniProt 26–130 Author chain Ln； PDBConstruct 1–104； UniProt 26–130 Author chain Lo； PDBConstruct 1–104； UniProt 26–130 Author chain Lp； PDBConstruct 1–104； UniProt 26–130 Author chain Lq； PDBConstruct 1–104； UniProt 26–130 Author chain Lr； PDBConstruct 1–104； UniProt 26–130 Author chain Ls； PDBConstruct 1–104； UniProt 26–130 Author chain Lt； PDBConstruct 1–104； UniProt 26–130 Author chain Lu； PDBConstruct 1–104； UniProt 26–130 Author chain Lv； PDBConstruct 1–104； UniProt 26–130 Author chain Lw； PDBConstruct 1–104； UniProt 26–130 Author chain Lx； PDBConstruct 1–104； UniProt 26–130 Author chain Ly； PDBConstruct 1–104； UniProt 26–130 Author chain Lz； PDBConstruct 1–104； UniProt 26–130 Author chain Ma； PDBConstruct 1–104； UniProt 26–130 Author chain Mb； PDBConstruct 1–104； UniProt 26–130 Author chain Mc； PDBConstruct 1–104； UniProt 26–130

Chemotaxis protein PomB

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KTK9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 407 PDB declaration: 407-meric（407） Consistent with protein copy count	Chain Ix； UniProt 146–300 Chain Iy； UniProt 146–300 Chain Iz； UniProt 146–300 Chain Ja； UniProt 146–300 Chain Jb； UniProt 146–300 Chain Jc； UniProt 146–300 Chain Jd； UniProt 146–300 Chain Je； UniProt 146–300 Chain Jf； UniProt 146–300 Chain Jg； UniProt 146–300 Chain Jh； UniProt 146–300 Chain Ji； UniProt 146–300 Chain Jj； UniProt 146–300 Chain Jk； UniProt 146–300 Chain Jl； UniProt 146–300 Chain Jm； UniProt 146–300 Chain Jn； UniProt 146–300 Chain Jo； UniProt 146–300 Chain Jp； UniProt 146–300 Chain Jq； UniProt 146–300 Chain Jr； UniProt 146–300 Chain Js； UniProt 146–300 Chain Jt； UniProt 146–300 Chain Ju； UniProt 146–300 Chain Jv； UniProt 146–300 Chain Jw； UniProt 146–300	Not recorded	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00） Flagellar M-ring protein × 34 （Q9KQ69）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YH7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YED T-ring-PomB complex in Vibrio cholerae Deposited 2025-09-24	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain CP1 146–300（155 aa） Chain DP1 146–300（155 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 4.98 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Ix 146–300（155 aa） Chain Iy 146–300（155 aa） Chain Iz 146–300（155 aa） Chain Ja 146–300（155 aa） Chain Jb 146–300（155 aa） Chain Jc 146–300（155 aa） Chain Jd 146–300（155 aa） Chain Je 146–300（155 aa） Chain Jf 146–300（155 aa） Chain Jg 146–300（155 aa） Chain Jh 146–300（155 aa） Chain Ji 146–300（155 aa） Chain Jj 146–300（155 aa） Chain Jk 146–300（155 aa） Chain Jl 146–300（155 aa） Chain Jm 146–300（155 aa） Chain Jn 146–300（155 aa） Chain Jo 146–300（155 aa） Chain Jp 146–300（155 aa） Chain Jq 146–300（155 aa） Chain Jr 146–300（155 aa） Chain Js 146–300（155 aa） Chain Jt 146–300（155 aa） Chain Ju 146–300（155 aa） Chain Jv 146–300（155 aa） Chain Jw 146–300（155 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9KTK9_VIBCH
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Ix； PDBConstruct 1–155； UniProt 146–300 Author chain Iy； PDBConstruct 1–155； UniProt 146–300 Author chain Iz； PDBConstruct 1–155； UniProt 146–300 Author chain Ja； PDBConstruct 1–155； UniProt 146–300 Author chain Jb； PDBConstruct 1–155； UniProt 146–300 Author chain Jc； PDBConstruct 1–155； UniProt 146–300 Author chain Jd； PDBConstruct 1–155； UniProt 146–300 Author chain Je； PDBConstruct 1–155； UniProt 146–300 Author chain Jf； PDBConstruct 1–155； UniProt 146–300 Author chain Jg； PDBConstruct 1–155； UniProt 146–300 Author chain Jh； PDBConstruct 1–155； UniProt 146–300 Author chain Ji； PDBConstruct 1–155； UniProt 146–300 Author chain Jj； PDBConstruct 1–155； UniProt 146–300 Author chain Jk； PDBConstruct 1–155； UniProt 146–300 Author chain Jl； PDBConstruct 1–155； UniProt 146–300 Author chain Jm； PDBConstruct 1–155； UniProt 146–300 Author chain Jn； PDBConstruct 1–155； UniProt 146–300 Author chain Jo； PDBConstruct 1–155； UniProt 146–300 Author chain Jp； PDBConstruct 1–155； UniProt 146–300 Author chain Jq； PDBConstruct 1–155； UniProt 146–300 Author chain Jr； PDBConstruct 1–155； UniProt 146–300 Author chain Js； PDBConstruct 1–155； UniProt 146–300 Author chain Jt； PDBConstruct 1–155； UniProt 146–300 Author chain Ju； PDBConstruct 1–155； UniProt 146–300 Author chain Jv； PDBConstruct 1–155； UniProt 146–300 Author chain Jw； PDBConstruct 1–155； UniProt 146–300

FlgO domain-containing protein

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ00

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 407 PDB declaration: 407-meric（407） Consistent with protein copy count	Chain Md； UniProt 32–221 Chain Me； UniProt 32–221 Chain Mf； UniProt 32–221 Chain Mg； UniProt 32–221 Chain Mh； UniProt 32–221 Chain Mi； UniProt 32–221 Chain Mj； UniProt 32–221 Chain Mk； UniProt 32–221 Chain Ml； UniProt 32–221 Chain Mm； UniProt 32–221 Chain Mn； UniProt 32–221 Chain Mo； UniProt 32–221 Chain Mp； UniProt 32–221 Chain Mq； UniProt 32–221 Chain Mr； UniProt 32–221 Chain Ms； UniProt 32–221 Chain Mt； UniProt 32–221 Chain Mu； UniProt 32–221 Chain Mv； UniProt 32–221 Chain Mw； UniProt 32–221 Chain Mx； UniProt 32–221 Chain My； UniProt 32–221 Chain Mz； UniProt 32–221 Chain Na； UniProt 32–221 Chain Nb； UniProt 32–221 Chain Nc； UniProt 32–221 Chain Nd； UniProt 32–221 Chain Ne； UniProt 32–221 Chain Nf； UniProt 32–221 Chain Ng； UniProt 32–221 Chain Nh； UniProt 32–221 Chain Ni； UniProt 32–221 Chain Nj； UniProt 32–221 Chain Nk； UniProt 32–221 Chain Nl； UniProt 32–221 Chain Nm； UniProt 32–221 Chain Nn； UniProt 32–221 Chain No； UniProt 32–221 Chain Np； UniProt 32–221 Chain Nq； UniProt 32–221 Chain Nr； UniProt 32–221 Chain Ns； UniProt 32–221 Chain Nt； UniProt 32–221 Chain Nu； UniProt 32–221 Chain Nv； UniProt 32–221 Chain Nw； UniProt 32–221 Chain Nx； UniProt 32–221 Chain Ny； UniProt 32–221 Chain Nz； UniProt 32–221 Chain Oa； UniProt 32–221 Chain Ob； UniProt 32–221 Chain Oc； UniProt 32–221 Chain Od； UniProt 32–221 Chain Oe； UniProt 32–221 Chain Of； UniProt 32–221 Chain Og； UniProt 32–221 Chain Oh； UniProt 32–221 Chain Oi； UniProt 32–221	Not recorded	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） Flagellar M-ring protein × 34 （Q9KQ69）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YH7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YDS H-ring subunit FlgO and FlgP in Vibrio cholerae at assembled, opened state Deposited 2025-09-23	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 116 PDB declaration: 116-meric	Chain Ab 30–221（192 aa） Chain Ad 30–221（192 aa） Chain Af 30–221（192 aa） Chain Ah 30–221（192 aa） Chain Aj 30–221（192 aa） Chain Al 30–221（192 aa） Chain An 30–221（192 aa） Chain Ap 30–221（192 aa） Chain Ar 30–221（192 aa） Chain At 30–221（192 aa） Chain Av 30–221（192 aa） Chain Ax 30–221（192 aa） Chain Az 30–221（192 aa） Chain Bb 30–221（192 aa） Chain Bd 30–221（192 aa） Chain Bf 30–221（192 aa） Chain Bh 30–221（192 aa） Chain Bj 30–221（192 aa） Chain Bl 30–221（192 aa） Chain Bn 30–221（192 aa） Chain Bp 30–221（192 aa） Chain Br 30–221（192 aa） Chain Bt 30–221（192 aa） Chain Bv 30–221（192 aa） Chain Bx 30–221（192 aa） Chain Bz 30–221（192 aa） Chain Cb 30–221（192 aa） Chain Cd 30–221（192 aa） Chain Cf 30–221（192 aa） Chain Ch 30–221（192 aa） Chain Cj 30–221（192 aa） Chain Cl 30–221（192 aa） Chain Cn 30–221（192 aa） Chain Cp 30–221（192 aa） Chain Cr 30–221（192 aa） Chain Ct 30–221（192 aa） Chain Cv 30–221（192 aa） Chain Cx 30–221（192 aa） Chain Cz 30–221（192 aa） Chain Db 30–221（192 aa） Chain Dd 30–221（192 aa） Chain Df 30–221（192 aa） Chain Dh 30–221（192 aa） Chain Dj 30–221（192 aa） Chain Dl 30–221（192 aa） Chain Dn 30–221（192 aa） Chain Dp 30–221（192 aa） Chain Dr 30–221（192 aa） Chain Dt 30–221（192 aa） Chain Dv 30–221（192 aa） Chain Dx 30–221（192 aa） Chain Dz 30–221（192 aa） Chain Eb 30–221（192 aa） Chain Ed 30–221（192 aa） Chain Ef 30–221（192 aa） Chain Eh 30–221（192 aa） Chain Ej 30–221（192 aa） Chain El 30–221（192 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.45 Å
9YFG Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state Deposited 2025-09-25	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 298 PDB declaration: 298-meric	Chain Hb 32–221（190 aa） Chain Hd 32–221（190 aa） Chain Hf 32–221（190 aa） Chain Hh 32–221（190 aa） Chain Hj 32–221（190 aa） Chain Hl 32–221（190 aa） Chain Hn 32–221（190 aa） Chain Hp 32–221（190 aa） Chain Hr 32–221（190 aa） Chain Ht 32–221（190 aa） Chain Hv 32–221（190 aa） Chain Hx 32–221（190 aa） Chain Hz 32–221（190 aa） Chain Ib 32–221（190 aa） Chain Id 32–221（190 aa） Chain If 32–221（190 aa） Chain Ih 32–221（190 aa） Chain Ij 32–221（190 aa） Chain Il 32–221（190 aa） Chain In 32–221（190 aa） Chain Ip 32–221（190 aa） Chain Ir 32–221（190 aa） Chain It 32–221（190 aa） Chain Iv 32–221（190 aa） Chain Ix 32–221（190 aa） Chain Iz 32–221（190 aa） Chain Jb 32–221（190 aa） Chain Jd 32–221（190 aa） Chain Jf 32–221（190 aa） Chain Jh 32–221（190 aa） Chain Jj 32–221（190 aa） Chain Jl 32–221（190 aa） Chain Jn 32–221（190 aa） Chain Jp 32–221（190 aa） Chain Jr 32–221（190 aa） Chain Jt 32–221（190 aa） Chain Jv 32–221（190 aa） Chain Jx 32–221（190 aa） Chain Jz 32–221（190 aa） Chain Kb 32–221（190 aa） Chain Kd 32–221（190 aa） Chain Kf 32–221（190 aa） Chain Kh 32–221（190 aa） Chain Kj 32–221（190 aa） Chain Kl 32–221（190 aa） Chain Kn 32–221（190 aa） Chain Kp 32–221（190 aa） Chain Kr 32–221（190 aa） Chain Kt 32–221（190 aa） Chain Kv 32–221（190 aa） Chain Kx 32–221（190 aa） Chain Kz 32–221（190 aa） Chain Lb 32–221（190 aa） Chain Ld 32–221（190 aa） Chain Lf 32–221（190 aa） Chain Lh 32–221（190 aa） Chain Lj 32–221（190 aa） Chain Ll 32–221（190 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.55 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Md 32–221（190 aa） Chain Me 32–221（190 aa） Chain Mf 32–221（190 aa） Chain Mg 32–221（190 aa） Chain Mh 32–221（190 aa） Chain Mi 32–221（190 aa） Chain Mj 32–221（190 aa） Chain Mk 32–221（190 aa） Chain Ml 32–221（190 aa） Chain Mm 32–221（190 aa） Chain Mn 32–221（190 aa） Chain Mo 32–221（190 aa） Chain Mp 32–221（190 aa） Chain Mq 32–221（190 aa） Chain Mr 32–221（190 aa） Chain Ms 32–221（190 aa） Chain Mt 32–221（190 aa） Chain Mu 32–221（190 aa） Chain Mv 32–221（190 aa） Chain Mw 32–221（190 aa） Chain Mx 32–221（190 aa） Chain My 32–221（190 aa） Chain Mz 32–221（190 aa） Chain Na 32–221（190 aa） Chain Nb 32–221（190 aa） Chain Nc 32–221（190 aa） Chain Nd 32–221（190 aa） Chain Ne 32–221（190 aa） Chain Nf 32–221（190 aa） Chain Ng 32–221（190 aa） Chain Nh 32–221（190 aa） Chain Ni 32–221（190 aa） Chain Nj 32–221（190 aa） Chain Nk 32–221（190 aa） Chain Nl 32–221（190 aa） Chain Nm 32–221（190 aa） Chain Nn 32–221（190 aa） Chain No 32–221（190 aa） Chain Np 32–221（190 aa） Chain Nq 32–221（190 aa） Chain Nr 32–221（190 aa） Chain Ns 32–221（190 aa） Chain Nt 32–221（190 aa） Chain Nu 32–221（190 aa） Chain Nv 32–221（190 aa） Chain Nw 32–221（190 aa） Chain Nx 32–221（190 aa） Chain Ny 32–221（190 aa） Chain Nz 32–221（190 aa） Chain Oa 32–221（190 aa） Chain Ob 32–221（190 aa） Chain Oc 32–221（190 aa） Chain Od 32–221（190 aa） Chain Oe 32–221（190 aa） Chain Of 32–221（190 aa） Chain Og 32–221（190 aa） Chain Oh 32–221（190 aa） Chain Oi 32–221（190 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9KQ00_VIBCH
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain Md； PDBConstruct 1–190； UniProt 32–221 Author chain Me； PDBConstruct 1–190； UniProt 32–221 Author chain Mf； PDBConstruct 1–190； UniProt 32–221 Author chain Mg； PDBConstruct 1–190； UniProt 32–221 Author chain Mh； PDBConstruct 1–190； UniProt 32–221 Author chain Mi； PDBConstruct 1–190； UniProt 32–221 Author chain Mj； PDBConstruct 1–190； UniProt 32–221 Author chain Mk； PDBConstruct 1–190； UniProt 32–221 Author chain Ml； PDBConstruct 1–190； UniProt 32–221 Author chain Mm； PDBConstruct 1–190； UniProt 32–221 Author chain Mn； PDBConstruct 1–190； UniProt 32–221 Author chain Mo； PDBConstruct 1–190； UniProt 32–221 Author chain Mp； PDBConstruct 1–190； UniProt 32–221 Author chain Mq； PDBConstruct 1–190； UniProt 32–221 Author chain Mr； PDBConstruct 1–190； UniProt 32–221 Author chain Ms； PDBConstruct 1–190； UniProt 32–221 Author chain Mt； PDBConstruct 1–190； UniProt 32–221 Author chain Mu； PDBConstruct 1–190； UniProt 32–221 Author chain Mv； PDBConstruct 1–190； UniProt 32–221 Author chain Mw； PDBConstruct 1–190； UniProt 32–221 Author chain Mx； PDBConstruct 1–190； UniProt 32–221 Author chain My； PDBConstruct 1–190； UniProt 32–221 Author chain Mz； PDBConstruct 1–190； UniProt 32–221 Author chain Na； PDBConstruct 1–190； UniProt 32–221 Author chain Nb； PDBConstruct 1–190； UniProt 32–221 Author chain Nc； PDBConstruct 1–190； UniProt 32–221 Author chain Nd； PDBConstruct 1–190； UniProt 32–221 Author chain Ne； PDBConstruct 1–190； UniProt 32–221 Author chain Nf； PDBConstruct 1–190； UniProt 32–221 Author chain Ng； PDBConstruct 1–190； UniProt 32–221 Author chain Nh； PDBConstruct 1–190； UniProt 32–221 Author chain Ni； PDBConstruct 1–190； UniProt 32–221 Author chain Nj； PDBConstruct 1–190； UniProt 32–221 Author chain Nk； PDBConstruct 1–190； UniProt 32–221 Author chain Nl； PDBConstruct 1–190； UniProt 32–221 Author chain Nm； PDBConstruct 1–190； UniProt 32–221 Author chain Nn； PDBConstruct 1–190； UniProt 32–221 Author chain No； PDBConstruct 1–190； UniProt 32–221 Author chain Np； PDBConstruct 1–190； UniProt 32–221 Author chain Nq； PDBConstruct 1–190； UniProt 32–221 Author chain Nr； PDBConstruct 1–190； UniProt 32–221 Author chain Ns； PDBConstruct 1–190； UniProt 32–221 Author chain Nt； PDBConstruct 1–190； UniProt 32–221 Author chain Nu； PDBConstruct 1–190； UniProt 32–221 Author chain Nv； PDBConstruct 1–190； UniProt 32–221 Author chain Nw； PDBConstruct 1–190； UniProt 32–221 Author chain Nx； PDBConstruct 1–190； UniProt 32–221 Author chain Ny； PDBConstruct 1–190； UniProt 32–221 Author chain Nz； PDBConstruct 1–190； UniProt 32–221 Author chain Oa； PDBConstruct 1–190； UniProt 32–221 Author chain Ob； PDBConstruct 1–190； UniProt 32–221 Author chain Oc； PDBConstruct 1–190； UniProt 32–221 Author chain Od； PDBConstruct 1–190； UniProt 32–221 Author chain Oe； PDBConstruct 1–190； UniProt 32–221 Author chain Of； PDBConstruct 1–190； UniProt 32–221 Author chain Og； PDBConstruct 1–190； UniProt 32–221 Author chain Oh； PDBConstruct 1–190； UniProt 32–221 Author chain Oi； PDBConstruct 1–190； UniProt 32–221

Flagellar M-ring protein

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ69

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 407 PDB declaration: 407-meric（407） Consistent with protein copy count	Chain Oj； UniProt 256–453 Chain Ok； UniProt 256–453 Chain Ol； UniProt 256–453 Chain Om； UniProt 256–453 Chain On； UniProt 256–453 Chain Oo； UniProt 256–453 Chain Op； UniProt 256–453 Chain Oq； UniProt 256–453 Chain Or； UniProt 256–453 Chain Os； UniProt 256–453 Chain Ot； UniProt 256–453 Chain Ou； UniProt 256–453 Chain Ov； UniProt 256–453 Chain Ow； UniProt 256–453 Chain Ox； UniProt 256–453 Chain Oy； UniProt 256–453 Chain Oz； UniProt 256–453 Chain Pa； UniProt 256–453 Chain Pb； UniProt 256–453 Chain Pc； UniProt 256–453 Chain Pd； UniProt 256–453 Chain Pe； UniProt 256–453 Chain Pf； UniProt 256–453 Chain Pg； UniProt 256–453 Chain Ph； UniProt 256–453 Chain Pi； UniProt 256–453 Chain Pj； UniProt 256–453 Chain Pk； UniProt 256–453 Chain Pl； UniProt 256–453 Chain Pm； UniProt 256–453 Chain Pn； UniProt 256–453 Chain Po； UniProt 256–453 Chain Pp； UniProt 256–453 Chain Pq； UniProt 256–453	Not recorded	Flagellar basal-body rod protein FlgG × 27 （Q9KQ12） Flagellar basal-body rod protein FlgF × 5 （Q9KQ11） Flagellar hook protein FlgE × 17 （A0A085QTL5） Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 （Q9KQ01） Chemotaxis protein PomB × 26 （Q9KTK9） FlgP × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YH7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YDX RBM3 domain of FliF protein in MS-ring of flagellar motor in Vibrio cholerae Deposited 2025-09-23	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain Aa 256–453（198 aa） Chain Ab 256–453（198 aa） Chain Ac 256–453（198 aa） Chain Ad 256–453（198 aa） Chain Ae 256–453（198 aa） Chain Af 256–453（198 aa） Chain Ag 256–453（198 aa） Chain Ah 256–453（198 aa） Chain Ai 256–453（198 aa） Chain Aj 256–453（198 aa） Chain Ak 256–453（198 aa） Chain Al 256–453（198 aa） Chain Am 256–453（198 aa） Chain An 256–453（198 aa） Chain Ao 256–453（198 aa） Chain Ap 256–453（198 aa） Chain Aq 256–453（198 aa） Chain Ar 256–453（198 aa） Chain As 256–453（198 aa） Chain At 256–453（198 aa） Chain Au 256–453（198 aa） Chain Av 256–453（198 aa） Chain Aw 256–453（198 aa） Chain Ax 256–453（198 aa） Chain Ay 256–453（198 aa） Chain Az 256–453（198 aa） Chain Ba 256–453（198 aa） Chain Bb 256–453（198 aa） Chain Bc 256–453（198 aa） Chain Bd 256–453（198 aa） Chain Be 256–453（198 aa） Chain Bf 256–453（198 aa） Chain Bg 256–453（198 aa） Chain Bh 256–453（198 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.75 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9KQ69_VIBCH
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Oj； PDBConstruct 1–198； UniProt 256–453 Author chain Ok； PDBConstruct 1–198； UniProt 256–453 Author chain Ol； PDBConstruct 1–198； UniProt 256–453 Author chain Om； PDBConstruct 1–198； UniProt 256–453 Author chain On； PDBConstruct 1–198； UniProt 256–453 Author chain Oo； PDBConstruct 1–198； UniProt 256–453 Author chain Op； PDBConstruct 1–198； UniProt 256–453 Author chain Oq； PDBConstruct 1–198； UniProt 256–453 Author chain Or； PDBConstruct 1–198； UniProt 256–453 Author chain Os； PDBConstruct 1–198； UniProt 256–453 Author chain Ot； PDBConstruct 1–198； UniProt 256–453 Author chain Ou； PDBConstruct 1–198； UniProt 256–453 Author chain Ov； PDBConstruct 1–198； UniProt 256–453 Author chain Ow； PDBConstruct 1–198； UniProt 256–453 Author chain Ox； PDBConstruct 1–198； UniProt 256–453 Author chain Oy； PDBConstruct 1–198； UniProt 256–453 Author chain Oz； PDBConstruct 1–198； UniProt 256–453 Author chain Pa； PDBConstruct 1–198； UniProt 256–453 Author chain Pb； PDBConstruct 1–198； UniProt 256–453 Author chain Pc； PDBConstruct 1–198； UniProt 256–453 Author chain Pd； PDBConstruct 1–198； UniProt 256–453 Author chain Pe； PDBConstruct 1–198； UniProt 256–453 Author chain Pf； PDBConstruct 1–198； UniProt 256–453 Author chain Pg； PDBConstruct 1–198； UniProt 256–453 Author chain Ph； PDBConstruct 1–198； UniProt 256–453 Author chain Pi； PDBConstruct 1–198； UniProt 256–453 Author chain Pj； PDBConstruct 1–198； UniProt 256–453 Author chain Pk； PDBConstruct 1–198； UniProt 256–453 Author chain Pl； PDBConstruct 1–198； UniProt 256–453 Author chain Pm； PDBConstruct 1–198； UniProt 256–453 Author chain Pn； PDBConstruct 1–198； UniProt 256–453 Author chain Po； PDBConstruct 1–198； UniProt 256–453 Author chain Pp； PDBConstruct 1–198； UniProt 256–453 Author chain Pq； PDBConstruct 1–198； UniProt 256–453

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9yh7
Deposition date deposition_date	2025-09-30
Structure title title	Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a higher FOMC conformation
Keywords keywords	Motor protein, Sheathed flagellar motor, Vibrio cholerae; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	— Å
Radius of gyration Rg (electron density) rg_electron	152.00 Å
Forward intensity I(0) i0	952856000000.00
Molecular weight molecular_weight	8178100.0 kDa
Excluded volume excluded_volume	10160000 Å³
Envelope volume envelope_volume	18472000 Å³
Hydration-shell volume shell_volume	938850 Å³
Envelope diameter envelope_diameter	471.7 Å
Shell Rg shell_rg	158.90 Å
Envelope Rg envelope_rg	152.10 Å
Shape Rg shape_rg	152.00 Å
Total Rg total_rg	152.00 Å
Total atoms total_atoms	574924
Residues n_residues	73994
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	471.4 Å
Rg (real space) rg_real	153.10 Å
Rg uncertainty (real space) rg_real_error	2.07 Å
I(0) (real space) i0_real	9.2830e+11
I(0) uncertainty (real space) i0_real_error	2.1850e+10
Rg (reciprocal space) rg_reciprocal	153.40 Å
I(0) (reciprocal space) i0_reciprocal	948000000000.0000
Solution quality estimate total_estimate	0.8915
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	188.5 Å
Skewness Skewness skewness	0.237
Kurtosis Kurtosis kurtosis	-0.490
Angular range angular_range	— – 0.0500 Å⁻¹
Current regularization parameter α current_alpha	1.8150
Highest regularization parameter α highest_alpha	38990000000.0000
Real-space data points n_real_points	11
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.965; Stabil: 0.924; Sysdev: 1.000; Positv: 1.000; Valcen: 0.934; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	Flagellar basal-body rod protein FlgG
Molecular weight formula_weight	28114.3 kDa
Source method src_method	man
Copy count entity_count	27

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa,Ab,Ac,Ad,Ae,Af,Ag,Ah,Ai,Aj,Ak,Al,Am,An,Ao,Ap,Aq,Ar,As,At,Au,Av,Aw,Ax,Ay,Az,Bb
Atom count atom_count	574924

MQPALWVSKTGLDAQQTNIATISNNLANASTIGFKKGRAVFEDLFYQNINQPGAQSSQNTRLPSGLMLGAGSKVVATQKVHTNGNVQTTSNSLDMMIEGDGFFQILMPDGNIAYSRNGQFTLDDEGAIVTSGAGYRLQPEIIIPEDAISITIGNDGEVSVRVRGQQDNQVLGQITTVDFINPGGLEPVGQNLYLPTGASGEPQEGVPGLDGLGDIRQSMLETSNVNVTEELVNMIEAQRVYEMNSKVISAVDKMMSFVNQQL

来源 Source

来源生物 organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI Class编号 ncbi_taxonomy_id	243277
宿主生物 host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 2 Entity 2 polymer

Description description	Flagellar basal-body rod protein FlgF
Molecular weight formula_weight	26778.3 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ba,Bc,Bd,Bv,Bw

MDRALFLAMSGAKQNMQAMQLRANNLANVSTTGFRADLAQARSMQAYGEGLPSRVFSMTERPGHNFAQGSVITTGRDLDITIQGDGWISVLDKTGKEGLTRNGNLRIDETGLLLNGNGHPVLGETGAPITLPVPLNKVEIGGDGTISVRPQGAPADAMEVVDRIKLVRLNDQSLFKDVNGLFRATDPNTQFEADASVKILTGALEGSNVNAIGEMTSLIDLQRQFEMQVKMMSTAEEMDKASDSLLRSS

来源 Source

来源生物 organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI Class编号 ncbi_taxonomy_id	243277
宿主生物 host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 3 Entity 3 polymer

Description description	Flagellar hook protein FlgE
Molecular weight formula_weight	46880.3 kDa
Source method src_method	man
Copy count entity_count	17

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Be,Bf,Bg,Bh,Bi,Bj,Bk,Bl,Bm,Bn,Bo,Bp,Bq,Br,Bs,Bt,Bu

MSYVSLSGLSAAQMDLNTTSNNIANANTFGFKESRAEFGDVYSTSLFTNAKTTPGQGVQAAKVAQQFHEGSSIYTNNPLDLRIAGTGFFAVAKDRLVPQQNELTRNGAFHLDKNSFMVTANDEFLLGYEVNPDTGDVLSYEPKPINIPPQFGKPKQTANIDLGANLPANGDLKDPALFDITDPETYNRTTSSTIYDSMGQPYKLTTYYLKDMNQANTWQTYYTVTDKTGEKPINVVGGDAASPTGHVGHTMRFNNDGTLSSLNNGQPIVTEPLGGGANPVDLNGADVNQTLSFSLDSATQFAAPFELTKFDQDGATTGFLTKIDFDENGSVLATYSNGINTTLGRVALVRVANEQGLDKKGGTQWDATQFSGAKIWGESNKGSFGSISNGSLEQSNIDMTQELVDLISAQRNFQANSRALEVHNGLQQNILQIR

来源 Source

来源生物 organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI Class编号 ncbi_taxonomy_id	243277
宿主生物 host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 4 Entity 4 polymer

Description description	Flagellar L-ring protein
Molecular weight formula_weight	24256.5 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bx,By,Bz,Ca,Cb,Cc,Cd,Ce,Cf,Cg,Ch,Ci,Cj,Ck,Cl,Cm,Cn,Co,Cp,Cq,Cr,Cs,Ct,Cu,Cv,Cw

TTTVDAVEGDKSESNSGLTDALRNRTDPVAGDPAWAPIHPKGKPEHYAAETGSLFNLASSSSMYDDSKPRGVGDIITVTLNESTKAAKSADADLNKKNDASMDPLAVGGKDLTIGDYNFSYALKNDNKFSGSAAANQSNSMSGSITVEVIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEPGFLARFFNVSL

来源 Source

来源生物 organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI Class编号 ncbi_taxonomy_id	243277
宿主生物 host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 5 Entity 5 polymer

Description description	Flagellar P-ring protein
Molecular weight formula_weight	35702.6 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Cx,Cy,Cz,Da,Db,Dc,Dd,De,Df,Dg,Dh,Di,Dj,Dk,Dl,Dm,Dn,Do,Dp,Dq,Dr,Ds,Dt,Du,Dv,Dw

ARIKDVAQVAGVRNNQLVGYGLVTGLPGTGESTPFTDQSFNAMLQSFGIQLPPGTKPKTKNVAAVIVTADLPAFSKQGQTIDITVSSIGSAKSLRGGTLMQTFLKGLDGQVYAVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGDYITFNLFESDFTTAQRLADAVNQFLGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENLEFNPADSAAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNALGGGQTVVVPNTEIEVTEKQGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLIII

来源 Source

来源生物 organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI Class编号 ncbi_taxonomy_id	243277
宿主生物 host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 6 Entity 6 polymer

Description description	Flagellar protein FlgT
Molecular weight formula_weight	39808.2 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Dx,Dy,Dz,Ea,Eb,Ec,Ed,Ee,Ef,Eg,Eh,Ei,Ej,Ek,El,Em,En,Eo,Ep,Eq,Er,Es,Et,Eu,Ev,Ew

YEVTGSAAIVSSEEVARLHALEDALYKAVNFAGADIGSISNLMPLLESDRREYLFANHEVRYILIEERKAINNVMYVRTRIDIYPSATACHVEQYKKTMLIGNIDLASPQQAVMGQIYQVGDDFAQVINRRLEQESRSFVSVGTTQYDIDPKAPERIKMIAQDAGAQYIMGGMITDLTATIEQKTLQDDIINRQFAMEISVFDGKTGNEVMTRTYREVARWPFPKTSQIDTRSARFWASTYGEMMLRVSRNIMLDLESEISCKITLPQIVAKFGTTATMDLGRIHGVKQGDKLSLWHTGAFIDQQGLPRNKVTQSEITLTVSRVYEHEAELTVDQPELAYSIQIGDVMHKQM

来源 Source

来源生物 organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI Class编号 ncbi_taxonomy_id	243277
宿主生物 host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 7 Entity 7 polymer

Description description	Sodium-type flagellar protein MotY
Molecular weight formula_weight	31208.0 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ex,Ey,Ez,Fa,Fb,Fc,Fd,Fe,Ff,Fg,Fh,Fi,Fj,Fk,Fl,Fm,Fn,Fo,Fp,Fq,Fr,Fs,Ft,Fu,Fv,Fw

LEVRYMATPQQSTWQMATNTPLECRLVHPIPNYGDAEFSSRAGKKINLDFELKMRRPMGDTRNVSLVSMPPVWRPGEGADRITNLQFFKQFDGYIGGQTAWSLLSELEKGRYPTFSYQDWQSRDQRIEVALSSVLFQQPYNEFSDCISKLLPYSFEDISFTILHYDQGTSVELNKASQKRLAQIAEYVRYNQDIDLVLVSTYTDSTDTNNNSQNLSEQRAEVLREYFKSIGLPEDRIQVQGYGKRRPIADNASPIGKDKNRRVVISLGRTQ

来源 Source

来源生物 organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI Class编号 ncbi_taxonomy_id	243277
宿主生物 host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 8 Entity 8 polymer

Description description	Sodium-type flagellar protein MotX
Molecular weight formula_weight	21244.1 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Fx,Fy,Fz,Ga,Gb,Gc,Gd,Ge,Gf,Gg,Gh,Gi,Gj,Gk,Gl,Gm,Gn,Go,Gp,Gq,Gr,Gs,Gt,Gu,Gv,Gw

PVPIYSEAELIKLIEENKHLERVKADNCQIVEDIVARATRISLPSYEFLYGDMLAWGVCVDQDVELGLYYMENAAHQGLPAALEQLGRYYSRGTLVQQDKERAIPYLREAAAMGNLNARIQLAELLLRDYGSPLDYEDAYRWLYNSVTADQRTHNRIALLRQGLERRMPENIIARAKRRETFW

来源 Source

来源生物 organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI Class编号 ncbi_taxonomy_id	243277
宿主生物 host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 9 Entity 9 polymer

Description description	FlgP
Molecular weight formula_weight	1506.8 kDa
Source method src_method	man
Copy count entity_count	52

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;Gx,Gy,Gz,Ha,Hb,Hc,Hd,He,Hf,Hg,Hh,Hi,Hj,Hk,Hl,Hm,Hn,Ho,Hp,Hq,Hr,Hs,Ht,Hu,Hv,Hw,Hx,Hy,Hz,Ia,Ib,Ic,Id,Ie,If,Ig,Ih,Ii,Ij,Ik,Il,Im,In,Io,Ip,Iq,Ir,Is,It,Iu,Iv,Iw ;

QQVPEKRQMTLF

来源 Source

来源生物 organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI Class编号 ncbi_taxonomy_id	243277
宿主生物 host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 10 Entity 10 polymer

Description description	Chemotaxis protein PomB
Molecular weight formula_weight	17542.8 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ix,Iy,Iz,Ja,Jb,Jc,Jd,Je,Jf,Jg,Jh,Ji,Jj,Jk,Jl,Jm,Jn,Jo,Jp,Jq,Jr,Js,Jt,Ju,Jv,Jw

QQQAQAMSEQMETVAESIKKALSREIEQGAIEVENLGQQIDIRIREKGAFPEGSAFLQPKFRPLVRQIAELVKDIPGKVRVTGHTDNQKLDSELYRSNWDLSAQRAVSVAQEMEKVKDFDHLRLQVRGLADTQPLGPNDTEAQRATNRRVEISIL

来源 Source

来源生物 organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI Class编号 ncbi_taxonomy_id	243277
宿主生物 host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 11 Entity 11 polymer

Description description	FlgP
Molecular weight formula_weight	11848.3 kDa
Source method src_method	man
Copy count entity_count	58

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;Jx,Jy,Jz,Ka,Kb,Kc,Kd,Ke,Kf,Kg,Kh,Ki,Kj,Kk,Kl,Km,Kn,Ko,Kp,Kq,Kr,Ks,Kt,Ku,Kv,Kw,Kx,Ky,Kz,La,Lb,Lc,Ld,Le,Lf,Lg,Lh,Li,Lj,Lk,Ll,Lm,Ln,Lo,Lp,Lq,Lr,Ls,Lt,Lu,Lv,Lw,Lx,Ly,Lz,Ma,Mb,Mc ;

PDDWLTAVGYANISEQRGRDEAEKQVRAMRASKIDAYRELAEQVYGMRISGRAELQDQRLGTELTAGADGVIRGAEVVRSYKVGDSYVTELRLDIRKMDKMRDY

来源 Source

来源生物 organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI Class编号 ncbi_taxonomy_id	243277
宿主生物 host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 12 Entity 12 polymer

Description description	FlgO domain-containing protein
Molecular weight formula_weight	21395.1 kDa
Source method src_method	man
Copy count entity_count	58

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;Md,Me,Mf,Mg,Mh,Mi,Mj,Mk,Ml,Mm,Mn,Mo,Mp,Mq,Mr,Ms,Mt,Mu,Mv,Mw,Mx,My,Mz,Na,Nb,Nc,Nd,Ne,Nf,Ng,Nh,Ni,Nj,Nk,Nl,Nm,Nn,No,Np,Nq,Nr,Ns,Nt,Nu,Nv,Nw,Nx,Ny,Nz,Oa,Ob,Oc,Od,Oe,Of,Og,Oh,Oi ;

IYNGKEPYNGSQFMLMESPRHTLDFFVESMTEDLMLSNTSITARTPIAVTSFVDLQNMDTTNWLGNSVSEGFIHQFQRRGFKVVDFKTTGSIQVTQQGDFAFSRDWKNLSSEQEVQYVLTGTMLRQEGGVIVNARVVGMHSRIVVATAQGFLPADRIGRDLDTLNSIRTQDGVLIRSDPTITQPYTVILR

来源 Source

来源生物 organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI Class编号 ncbi_taxonomy_id	243277
宿主生物 host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 13 Entity 13 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	21495.8 kDa
Source method src_method	man
Copy count entity_count	34

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Oj,Ok,Ol,Om,On,Oo,Op,Oq,Or,Os,Ot,Ou,Ov,Ow,Ox,Oy,Oz,Pa,Pb,Pc,Pd,Pe,Pf,Pg,Ph,Pi,Pj,Pk,Pl,Pm,Pn,Po,Pp,Pq

VSAARRKEQELEKQQEEALRGKIDSVLIPILGLGNYTAQVDIELDFSAVEQTRKVFDPNTPATRSEYTLEDYNNGNVVAGVPGALSNQPPADASIPQDVAQMKDGSVMGQGSVHKEATRNYELDTTISHERKQSGVINRQTVAVAVKSRSSVNPDTGEVTYTPLSEADLNSIRQVLIGTVGYSENRGDLLNVLSMPFA

来源 Source

来源生物 organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI Class编号 ncbi_taxonomy_id	243277
宿主生物 host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.60 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	5068

fit	/app/data/saxs_computation/yh/9yh7/9yh7.fit
pddf	/app/data/pr_computation/yh/9yh7/9yh7.pr.out
profile	/app/data/saxs_computation/yh/9yh7/9yh7.dat

Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a higher FOMC conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar basal-body rod protein FlgF

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar hook protein FlgE

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar L-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar P-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar protein FlgT

State in the Current Structure

Other States of the Same Protein in the Database

Sodium-type flagellar protein MotY

State in the Current Structure

Other States of the Same Protein in the Database

Sodium-type flagellar protein MotX

State in the Current Structure

Other States of the Same Protein in the Database

FlgP

State in the Current Structure

Other States of the Same Protein in the Database

Chemotaxis protein PomB

State in the Current Structure

Other States of the Same Protein in the Database

FlgO domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

Entity 6 Entity 6 polymer

Polymer Polymer

来源 Source

Entity 7 Entity 7 polymer

Polymer Polymer

来源 Source

Entity 8 Entity 8 polymer

Polymer Polymer

来源 Source

Entity 9 Entity 9 polymer

Polymer Polymer

来源 Source

Entity 10 Entity 10 polymer

Polymer Polymer

来源 Source

Entity 11 Entity 11 polymer

Polymer Polymer