SAXSdb — 9yec

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar L-ring protein

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 182 PDB declaration: 182-meric（182） Consistent with protein copy count	Chain Aa； UniProt 1–258 Chain Ab； UniProt 1–258 Chain Ac； UniProt 1–258 Chain Ad； UniProt 1–258 Chain Ae； UniProt 1–258 Chain Af； UniProt 1–258 Chain Ag； UniProt 1–258 Chain Ah； UniProt 1–258 Chain Ai； UniProt 1–258 Chain Aj； UniProt 1–258 Chain Ak； UniProt 1–258 Chain Al； UniProt 1–258 Chain Am； UniProt 1–258 Chain An； UniProt 1–258 Chain Ao； UniProt 1–258 Chain Ap； UniProt 1–258 Chain Aq； UniProt 1–258 Chain Ar； UniProt 1–258 Chain As； UniProt 1–258 Chain At； UniProt 1–258 Chain Au； UniProt 1–258 Chain Av； UniProt 1–258 Chain Aw； UniProt 1–258 Chain Ax； UniProt 1–258 Chain Ay； UniProt 1–258 Chain Az； UniProt 1–258	Not recorded	Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） Lipoprotein × 52 （Q9KQ01）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.57 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9YEC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YDO LPHT-ring in Vibrio cholerae at assembled, opened state Deposited 2025-09-22	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Aa 32–258（227 aa） Chain Ab 32–258（227 aa） Chain Ac 32–258（227 aa） Chain Ad 32–258（227 aa） Chain Ae 32–258（227 aa） Chain Af 32–258（227 aa） Chain Ag 32–258（227 aa） Chain Ah 32–258（227 aa） Chain Ai 32–258（227 aa） Chain Aj 32–258（227 aa） Chain Ak 32–258（227 aa） Chain Al 32–258（227 aa） Chain Am 32–258（227 aa） Chain An 32–258（227 aa） Chain Ao 32–258（227 aa） Chain Ap 32–258（227 aa） Chain Aq 32–258（227 aa） Chain Ar 32–258（227 aa） Chain As 32–258（227 aa） Chain At 32–258（227 aa） Chain Au 32–258（227 aa） Chain Av 32–258（227 aa） Chain Aw 32–258（227 aa） Chain Ax 32–258（227 aa） Chain Ay 32–258（227 aa） Chain Az 32–258（227 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.69 Å
9YDT LPHT-ring in Vibrio cholerae at disassembled, closed state Deposited 2025-09-23	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Aa 32–258（227 aa） Chain Ab 32–258（227 aa） Chain Ac 32–258（227 aa） Chain Ad 32–258（227 aa） Chain Ae 32–258（227 aa） Chain Af 32–258（227 aa） Chain Ag 32–258（227 aa） Chain Ah 32–258（227 aa） Chain Ai 32–258（227 aa） Chain Aj 32–258（227 aa） Chain Ak 32–258（227 aa） Chain Al 32–258（227 aa） Chain Am 32–258（227 aa） Chain An 32–258（227 aa） Chain Ao 32–258（227 aa） Chain Ap 32–258（227 aa） Chain Aq 32–258（227 aa） Chain Ar 32–258（227 aa） Chain As 32–258（227 aa） Chain At 32–258（227 aa） Chain Au 32–258（227 aa） Chain Av 32–258（227 aa） Chain Aw 32–258（227 aa） Chain Ax 32–258（227 aa） Chain Ay 32–258（227 aa） Chain Az 32–258（227 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.75 Å
9YFG Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state Deposited 2025-09-25	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 298 PDB declaration: 298-meric	Chain Aa 32–258（227 aa） Chain Ab 32–258（227 aa） Chain Ac 32–258（227 aa） Chain Ad 32–258（227 aa） Chain Ae 32–258（227 aa） Chain Af 32–258（227 aa） Chain Ag 32–258（227 aa） Chain Ah 32–258（227 aa） Chain Ai 32–258（227 aa） Chain Aj 32–258（227 aa） Chain Ak 32–258（227 aa） Chain Al 32–258（227 aa） Chain Am 32–258（227 aa） Chain An 32–258（227 aa） Chain Ao 32–258（227 aa） Chain Ap 32–258（227 aa） Chain Aq 32–258（227 aa） Chain Ar 32–258（227 aa） Chain As 32–258（227 aa） Chain At 32–258（227 aa） Chain Au 32–258（227 aa） Chain Av 32–258（227 aa） Chain Aw 32–258（227 aa） Chain Ax 32–258（227 aa） Chain Ay 32–258（227 aa） Chain Az 32–258（227 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.55 Å
9YH0 LPHT-ring subunit with C13 MotX in Vibrio cholerae at assembled state Deposited 2025-09-29	Different construct Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Aa 32–258（227 aa） Chain Ab 32–258（227 aa） Chain Ac 32–258（227 aa） Chain Ad 32–258（227 aa） Chain Ae 32–258（227 aa） Chain Af 32–258（227 aa） Chain Ag 32–258（227 aa） Chain Ah 32–258（227 aa） Chain Ai 32–258（227 aa） Chain Aj 32–258（227 aa） Chain Ak 32–258（227 aa） Chain Al 32–258（227 aa） Chain Am 32–258（227 aa） Chain An 32–258（227 aa） Chain Ao 32–258（227 aa） Chain Ap 32–258（227 aa） Chain Aq 32–258（227 aa） Chain Ar 32–258（227 aa） Chain As 32–258（227 aa） Chain At 32–258（227 aa） Chain Au 32–258（227 aa） Chain Av 32–258（227 aa） Chain Aw 32–258（227 aa） Chain Ax 32–258（227 aa） Chain Ay 32–258（227 aa） Chain Az 32–258（227 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Bx 32–258（227 aa） Chain By 32–258（227 aa） Chain Bz 32–258（227 aa） Chain Ca 32–258（227 aa） Chain Cb 32–258（227 aa） Chain Cc 32–258（227 aa） Chain Cd 32–258（227 aa） Chain Ce 32–258（227 aa） Chain Cf 32–258（227 aa） Chain Cg 32–258（227 aa） Chain Ch 32–258（227 aa） Chain Ci 32–258（227 aa） Chain Cj 32–258（227 aa） Chain Ck 32–258（227 aa） Chain Cl 32–258（227 aa） Chain Cm 32–258（227 aa） Chain Cn 32–258（227 aa） Chain Co 32–258（227 aa） Chain Cp 32–258（227 aa） Chain Cq 32–258（227 aa） Chain Cr 32–258（227 aa） Chain Cs 32–258（227 aa） Chain Ct 32–258（227 aa） Chain Cu 32–258（227 aa） Chain Cv 32–258（227 aa） Chain Cw 32–258（227 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH7 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a higher FOMC conformation Deposited 2025-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Bx 32–258（227 aa） Chain By 32–258（227 aa） Chain Bz 32–258（227 aa） Chain Ca 32–258（227 aa） Chain Cb 32–258（227 aa） Chain Cc 32–258（227 aa） Chain Cd 32–258（227 aa） Chain Ce 32–258（227 aa） Chain Cf 32–258（227 aa） Chain Cg 32–258（227 aa） Chain Ch 32–258（227 aa） Chain Ci 32–258（227 aa） Chain Cj 32–258（227 aa） Chain Ck 32–258（227 aa） Chain Cl 32–258（227 aa） Chain Cm 32–258（227 aa） Chain Cn 32–258（227 aa） Chain Co 32–258（227 aa） Chain Cp 32–258（227 aa） Chain Cq 32–258（227 aa） Chain Cr 32–258（227 aa） Chain Cs 32–258（227 aa） Chain Ct 32–258（227 aa） Chain Cu 32–258（227 aa） Chain Cv 32–258（227 aa） Chain Cw 32–258（227 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGH_VIBCH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–258； UniProt 1–258 Author chain Ab； PDBConstruct 1–258； UniProt 1–258 Author chain Ac； PDBConstruct 1–258； UniProt 1–258 Author chain Ad； PDBConstruct 1–258； UniProt 1–258 Author chain Ae； PDBConstruct 1–258； UniProt 1–258 Author chain Af； PDBConstruct 1–258； UniProt 1–258 Author chain Ag； PDBConstruct 1–258； UniProt 1–258 Author chain Ah； PDBConstruct 1–258； UniProt 1–258 Author chain Ai； PDBConstruct 1–258； UniProt 1–258 Author chain Aj； PDBConstruct 1–258； UniProt 1–258 Author chain Ak； PDBConstruct 1–258； UniProt 1–258 Author chain Al； PDBConstruct 1–258； UniProt 1–258 Author chain Am； PDBConstruct 1–258； UniProt 1–258 Author chain An； PDBConstruct 1–258； UniProt 1–258 Author chain Ao； PDBConstruct 1–258； UniProt 1–258 Author chain Ap； PDBConstruct 1–258； UniProt 1–258 Author chain Aq； PDBConstruct 1–258； UniProt 1–258 Author chain Ar； PDBConstruct 1–258； UniProt 1–258 Author chain As； PDBConstruct 1–258； UniProt 1–258 Author chain At； PDBConstruct 1–258； UniProt 1–258 Author chain Au； PDBConstruct 1–258； UniProt 1–258 Author chain Av； PDBConstruct 1–258； UniProt 1–258 Author chain Aw； PDBConstruct 1–258； UniProt 1–258 Author chain Ax； PDBConstruct 1–258； UniProt 1–258 Author chain Ay； PDBConstruct 1–258； UniProt 1–258 Author chain Az； PDBConstruct 1–258； UniProt 1–258

Flagellar P-ring protein

OrganismNot specified

UniProt Q9KQ14

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 182 PDB declaration: 182-meric（182） Consistent with protein copy count	Chain Ba； UniProt 1–361 Chain Bb； UniProt 1–361 Chain Bc； UniProt 1–361 Chain Bd； UniProt 1–361 Chain Be； UniProt 1–361 Chain Bf； UniProt 1–361 Chain Bg； UniProt 1–361 Chain Bh； UniProt 1–361 Chain Bi； UniProt 1–361 Chain Bj； UniProt 1–361 Chain Bk； UniProt 1–361 Chain Bl； UniProt 1–361 Chain Bm； UniProt 1–361 Chain Bn； UniProt 1–361 Chain Bo； UniProt 1–361 Chain Bp； UniProt 1–361 Chain Bq； UniProt 1–361 Chain Br； UniProt 1–361 Chain Bs； UniProt 1–361 Chain Bt； UniProt 1–361 Chain Bu； UniProt 1–361 Chain Bv； UniProt 1–361 Chain Bw； UniProt 1–361 Chain Bx； UniProt 1–361 Chain By； UniProt 1–361 Chain Bz； UniProt 1–361	Not recorded	Flagellar L-ring protein × 26 （Q9KQ13） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） Lipoprotein × 52 （Q9KQ01）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.57 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9YEC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YDO LPHT-ring in Vibrio cholerae at assembled, opened state Deposited 2025-09-22	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Ba 19–361（343 aa） Chain Bb 19–361（343 aa） Chain Bc 19–361（343 aa） Chain Bd 19–361（343 aa） Chain Be 19–361（343 aa） Chain Bf 19–361（343 aa） Chain Bg 19–361（343 aa） Chain Bh 19–361（343 aa） Chain Bi 19–361（343 aa） Chain Bj 19–361（343 aa） Chain Bk 19–361（343 aa） Chain Bl 19–361（343 aa） Chain Bm 19–361（343 aa） Chain Bn 19–361（343 aa） Chain Bo 19–361（343 aa） Chain Bp 19–361（343 aa） Chain Bq 19–361（343 aa） Chain Br 19–361（343 aa） Chain Bs 19–361（343 aa） Chain Bt 19–361（343 aa） Chain Bu 19–361（343 aa） Chain Bv 19–361（343 aa） Chain Bw 19–361（343 aa） Chain Bx 19–361（343 aa） Chain By 19–361（343 aa） Chain Bz 19–361（343 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.69 Å
9YDT LPHT-ring in Vibrio cholerae at disassembled, closed state Deposited 2025-09-23	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Ba 19–361（343 aa） Chain Bb 19–361（343 aa） Chain Bc 19–361（343 aa） Chain Bd 19–361（343 aa） Chain Be 19–361（343 aa） Chain Bf 19–361（343 aa） Chain Bg 19–361（343 aa） Chain Bh 19–361（343 aa） Chain Bi 19–361（343 aa） Chain Bj 19–361（343 aa） Chain Bk 19–361（343 aa） Chain Bl 19–361（343 aa） Chain Bm 19–361（343 aa） Chain Bn 19–361（343 aa） Chain Bo 19–361（343 aa） Chain Bp 19–361（343 aa） Chain Bq 19–361（343 aa） Chain Br 19–361（343 aa） Chain Bs 19–361（343 aa） Chain Bt 19–361（343 aa） Chain Bu 19–361（343 aa） Chain Bv 19–361（343 aa） Chain Bw 19–361（343 aa） Chain Bx 19–361（343 aa） Chain By 19–361（343 aa） Chain Bz 19–361（343 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.75 Å
9YFG Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state Deposited 2025-09-25	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 298 PDB declaration: 298-meric	Chain Ba 19–361（343 aa） Chain Bb 19–361（343 aa） Chain Bc 19–361（343 aa） Chain Bd 19–361（343 aa） Chain Be 19–361（343 aa） Chain Bf 19–361（343 aa） Chain Bg 19–361（343 aa） Chain Bh 19–361（343 aa） Chain Bi 19–361（343 aa） Chain Bj 19–361（343 aa） Chain Bk 19–361（343 aa） Chain Bl 19–361（343 aa） Chain Bm 19–361（343 aa） Chain Bn 19–361（343 aa） Chain Bo 19–361（343 aa） Chain Bp 19–361（343 aa） Chain Bq 19–361（343 aa） Chain Br 19–361（343 aa） Chain Bs 19–361（343 aa） Chain Bt 19–361（343 aa） Chain Bu 19–361（343 aa） Chain Bv 19–361（343 aa） Chain Bw 19–361（343 aa） Chain Bx 19–361（343 aa） Chain By 19–361（343 aa） Chain Bz 19–361（343 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.55 Å
9YH0 LPHT-ring subunit with C13 MotX in Vibrio cholerae at assembled state Deposited 2025-09-29	Different construct Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Ba 19–361（343 aa） Chain Bb 19–361（343 aa） Chain Bc 19–361（343 aa） Chain Bd 19–361（343 aa） Chain Be 19–361（343 aa） Chain Bf 19–361（343 aa） Chain Bg 19–361（343 aa） Chain Bh 19–361（343 aa） Chain Bi 19–361（343 aa） Chain Bj 19–361（343 aa） Chain Bk 19–361（343 aa） Chain Bl 19–361（343 aa） Chain Bm 19–361（343 aa） Chain Bn 19–361（343 aa） Chain Bo 19–361（343 aa） Chain Bp 19–361（343 aa） Chain Bq 19–361（343 aa） Chain Br 19–361（343 aa） Chain Bs 19–361（343 aa） Chain Bt 19–361（343 aa） Chain Bu 19–361（343 aa） Chain Bv 19–361（343 aa） Chain Bw 19–361（343 aa） Chain Bx 19–361（343 aa） Chain By 19–361（343 aa） Chain Bz 19–361（343 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Cx 19–361（343 aa） Chain Cy 19–361（343 aa） Chain Cz 19–361（343 aa） Chain Da 19–361（343 aa） Chain Db 19–361（343 aa） Chain Dc 19–361（343 aa） Chain Dd 19–361（343 aa） Chain De 19–361（343 aa） Chain Df 19–361（343 aa） Chain Dg 19–361（343 aa） Chain Dh 19–361（343 aa） Chain Di 19–361（343 aa） Chain Dj 19–361（343 aa） Chain Dk 19–361（343 aa） Chain Dl 19–361（343 aa） Chain Dm 19–361（343 aa） Chain Dn 19–361（343 aa） Chain Do 19–361（343 aa） Chain Dp 19–361（343 aa） Chain Dq 19–361（343 aa） Chain Dr 19–361（343 aa） Chain Ds 19–361（343 aa） Chain Dt 19–361（343 aa） Chain Du 19–361（343 aa） Chain Dv 19–361（343 aa） Chain Dw 19–361（343 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH7 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a higher FOMC conformation Deposited 2025-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Cx 19–361（343 aa） Chain Cy 19–361（343 aa） Chain Cz 19–361（343 aa） Chain Da 19–361（343 aa） Chain Db 19–361（343 aa） Chain Dc 19–361（343 aa） Chain Dd 19–361（343 aa） Chain De 19–361（343 aa） Chain Df 19–361（343 aa） Chain Dg 19–361（343 aa） Chain Dh 19–361（343 aa） Chain Di 19–361（343 aa） Chain Dj 19–361（343 aa） Chain Dk 19–361（343 aa） Chain Dl 19–361（343 aa） Chain Dm 19–361（343 aa） Chain Dn 19–361（343 aa） Chain Do 19–361（343 aa） Chain Dp 19–361（343 aa） Chain Dq 19–361（343 aa） Chain Dr 19–361（343 aa） Chain Ds 19–361（343 aa） Chain Dt 19–361（343 aa） Chain Du 19–361（343 aa） Chain Dv 19–361（343 aa） Chain Dw 19–361（343 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGI_VIBCH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain Ba； PDBConstruct 1–361； UniProt 1–361 Author chain Bb； PDBConstruct 1–361； UniProt 1–361 Author chain Bc； PDBConstruct 1–361； UniProt 1–361 Author chain Bd； PDBConstruct 1–361； UniProt 1–361 Author chain Be； PDBConstruct 1–361； UniProt 1–361 Author chain Bf； PDBConstruct 1–361； UniProt 1–361 Author chain Bg； PDBConstruct 1–361； UniProt 1–361 Author chain Bh； PDBConstruct 1–361； UniProt 1–361 Author chain Bi； PDBConstruct 1–361； UniProt 1–361 Author chain Bj； PDBConstruct 1–361； UniProt 1–361 Author chain Bk； PDBConstruct 1–361； UniProt 1–361 Author chain Bl； PDBConstruct 1–361； UniProt 1–361 Author chain Bm； PDBConstruct 1–361； UniProt 1–361 Author chain Bn； PDBConstruct 1–361； UniProt 1–361 Author chain Bo； PDBConstruct 1–361； UniProt 1–361 Author chain Bp； PDBConstruct 1–361； UniProt 1–361 Author chain Bq； PDBConstruct 1–361； UniProt 1–361 Author chain Br； PDBConstruct 1–361； UniProt 1–361 Author chain Bs； PDBConstruct 1–361； UniProt 1–361 Author chain Bt； PDBConstruct 1–361； UniProt 1–361 Author chain Bu； PDBConstruct 1–361； UniProt 1–361 Author chain Bv； PDBConstruct 1–361； UniProt 1–361 Author chain Bw； PDBConstruct 1–361； UniProt 1–361 Author chain Bx； PDBConstruct 1–361； UniProt 1–361 Author chain By； PDBConstruct 1–361； UniProt 1–361 Author chain Bz； PDBConstruct 1–361； UniProt 1–361

Flagellar protein FlgT

OrganismNot specified

UniProt Q9KPZ9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 182 PDB declaration: 182-meric（182） Consistent with protein copy count	Chain Ca； UniProt 1–377 Chain Cb； UniProt 1–377 Chain Cc； UniProt 1–377 Chain Cd； UniProt 1–377 Chain Ce； UniProt 1–377 Chain Cf； UniProt 1–377 Chain Cg； UniProt 1–377 Chain Ch； UniProt 1–377 Chain Ci； UniProt 1–377 Chain Cj； UniProt 1–377 Chain Ck； UniProt 1–377 Chain Cl； UniProt 1–377 Chain Cm； UniProt 1–377 Chain Cn； UniProt 1–377 Chain Co； UniProt 1–377 Chain Cp； UniProt 1–377 Chain Cq； UniProt 1–377 Chain Cr； UniProt 1–377 Chain Cs； UniProt 1–377 Chain Ct； UniProt 1–377 Chain Cu； UniProt 1–377 Chain Cv； UniProt 1–377 Chain Cw； UniProt 1–377 Chain Cx； UniProt 1–377 Chain Cy； UniProt 1–377 Chain Cz； UniProt 1–377	Not recorded	Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） Lipoprotein × 52 （Q9KQ01）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.57 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9YEC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YDO LPHT-ring in Vibrio cholerae at assembled, opened state Deposited 2025-09-22	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Ca 26–377（352 aa） Chain Cb 26–377（352 aa） Chain Cc 26–377（352 aa） Chain Cd 26–377（352 aa） Chain Ce 26–377（352 aa） Chain Cf 26–377（352 aa） Chain Cg 26–377（352 aa） Chain Ch 26–377（352 aa） Chain Ci 26–377（352 aa） Chain Cj 26–377（352 aa） Chain Ck 26–377（352 aa） Chain Cl 26–377（352 aa） Chain Cm 26–377（352 aa） Chain Cn 26–377（352 aa） Chain Co 26–377（352 aa） Chain Cp 26–377（352 aa） Chain Cq 26–377（352 aa） Chain Cr 26–377（352 aa） Chain Cs 26–377（352 aa） Chain Ct 26–377（352 aa） Chain Cu 26–377（352 aa） Chain Cv 26–377（352 aa） Chain Cw 26–377（352 aa） Chain Cx 26–377（352 aa） Chain Cy 26–377（352 aa） Chain Cz 26–377（352 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.69 Å
9YDT LPHT-ring in Vibrio cholerae at disassembled, closed state Deposited 2025-09-23	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Ca 26–377（352 aa） Chain Cb 26–377（352 aa） Chain Cc 26–377（352 aa） Chain Cd 26–377（352 aa） Chain Ce 26–377（352 aa） Chain Cf 26–377（352 aa） Chain Cg 26–377（352 aa） Chain Ch 26–377（352 aa） Chain Ci 26–377（352 aa） Chain Cj 26–377（352 aa） Chain Ck 26–377（352 aa） Chain Cl 26–377（352 aa） Chain Cm 26–377（352 aa） Chain Cn 26–377（352 aa） Chain Co 26–377（352 aa） Chain Cp 26–377（352 aa） Chain Cq 26–377（352 aa） Chain Cr 26–377（352 aa） Chain Cs 26–377（352 aa） Chain Ct 26–377（352 aa） Chain Cu 26–377（352 aa） Chain Cv 26–377（352 aa） Chain Cw 26–377（352 aa） Chain Cx 26–377（352 aa） Chain Cy 26–377（352 aa） Chain Cz 26–377（352 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.75 Å
9YFG Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state Deposited 2025-09-25	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 298 PDB declaration: 298-meric	Chain Ca 26–377（352 aa） Chain Cb 26–377（352 aa） Chain Cc 26–377（352 aa） Chain Cd 26–377（352 aa） Chain Ce 26–377（352 aa） Chain Cf 26–377（352 aa） Chain Cg 26–377（352 aa） Chain Ch 26–377（352 aa） Chain Ci 26–377（352 aa） Chain Cj 26–377（352 aa） Chain Ck 26–377（352 aa） Chain Cl 26–377（352 aa） Chain Cm 26–377（352 aa） Chain Cn 26–377（352 aa） Chain Co 26–377（352 aa） Chain Cp 26–377（352 aa） Chain Cq 26–377（352 aa） Chain Cr 26–377（352 aa） Chain Cs 26–377（352 aa） Chain Ct 26–377（352 aa） Chain Cu 26–377（352 aa） Chain Cv 26–377（352 aa） Chain Cw 26–377（352 aa） Chain Cx 26–377（352 aa） Chain Cy 26–377（352 aa） Chain Cz 26–377（352 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.55 Å
9YH0 LPHT-ring subunit with C13 MotX in Vibrio cholerae at assembled state Deposited 2025-09-29	Different construct Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Ca 26–377（352 aa） Chain Cb 26–377（352 aa） Chain Cc 26–377（352 aa） Chain Cd 26–377（352 aa） Chain Ce 26–377（352 aa） Chain Cf 26–377（352 aa） Chain Cg 26–377（352 aa） Chain Ch 26–377（352 aa） Chain Ci 26–377（352 aa） Chain Cj 26–377（352 aa） Chain Ck 26–377（352 aa） Chain Cl 26–377（352 aa） Chain Cm 26–377（352 aa） Chain Cn 26–377（352 aa） Chain Co 26–377（352 aa） Chain Cp 26–377（352 aa） Chain Cq 26–377（352 aa） Chain Cr 26–377（352 aa） Chain Cs 26–377（352 aa） Chain Ct 26–377（352 aa） Chain Cu 26–377（352 aa） Chain Cv 26–377（352 aa） Chain Cw 26–377（352 aa） Chain Cx 26–377（352 aa） Chain Cy 26–377（352 aa） Chain Cz 26–377（352 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Dx 26–377（352 aa） Chain Dy 26–377（352 aa） Chain Dz 26–377（352 aa） Chain Ea 26–377（352 aa） Chain Eb 26–377（352 aa） Chain Ec 26–377（352 aa） Chain Ed 26–377（352 aa） Chain Ee 26–377（352 aa） Chain Ef 26–377（352 aa） Chain Eg 26–377（352 aa） Chain Eh 26–377（352 aa） Chain Ei 26–377（352 aa） Chain Ej 26–377（352 aa） Chain Ek 26–377（352 aa） Chain El 26–377（352 aa） Chain Em 26–377（352 aa） Chain En 26–377（352 aa） Chain Eo 26–377（352 aa） Chain Ep 26–377（352 aa） Chain Eq 26–377（352 aa） Chain Er 26–377（352 aa） Chain Es 26–377（352 aa） Chain Et 26–377（352 aa） Chain Eu 26–377（352 aa） Chain Ev 26–377（352 aa） Chain Ew 26–377（352 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH7 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a higher FOMC conformation Deposited 2025-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Dx 26–377（352 aa） Chain Dy 26–377（352 aa） Chain Dz 26–377（352 aa） Chain Ea 26–377（352 aa） Chain Eb 26–377（352 aa） Chain Ec 26–377（352 aa） Chain Ed 26–377（352 aa） Chain Ee 26–377（352 aa） Chain Ef 26–377（352 aa） Chain Eg 26–377（352 aa） Chain Eh 26–377（352 aa） Chain Ei 26–377（352 aa） Chain Ej 26–377（352 aa） Chain Ek 26–377（352 aa） Chain El 26–377（352 aa） Chain Em 26–377（352 aa） Chain En 26–377（352 aa） Chain Eo 26–377（352 aa） Chain Ep 26–377（352 aa） Chain Eq 26–377（352 aa） Chain Er 26–377（352 aa） Chain Es 26–377（352 aa） Chain Et 26–377（352 aa） Chain Eu 26–377（352 aa） Chain Ev 26–377（352 aa） Chain Ew 26–377（352 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9KPZ9_VIBCH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain Ca； PDBConstruct 1–377； UniProt 1–377 Author chain Cb； PDBConstruct 1–377； UniProt 1–377 Author chain Cc； PDBConstruct 1–377； UniProt 1–377 Author chain Cd； PDBConstruct 1–377； UniProt 1–377 Author chain Ce； PDBConstruct 1–377； UniProt 1–377 Author chain Cf； PDBConstruct 1–377； UniProt 1–377 Author chain Cg； PDBConstruct 1–377； UniProt 1–377 Author chain Ch； PDBConstruct 1–377； UniProt 1–377 Author chain Ci； PDBConstruct 1–377； UniProt 1–377 Author chain Cj； PDBConstruct 1–377； UniProt 1–377 Author chain Ck； PDBConstruct 1–377； UniProt 1–377 Author chain Cl； PDBConstruct 1–377； UniProt 1–377 Author chain Cm； PDBConstruct 1–377； UniProt 1–377 Author chain Cn； PDBConstruct 1–377； UniProt 1–377 Author chain Co； PDBConstruct 1–377； UniProt 1–377 Author chain Cp； PDBConstruct 1–377； UniProt 1–377 Author chain Cq； PDBConstruct 1–377； UniProt 1–377 Author chain Cr； PDBConstruct 1–377； UniProt 1–377 Author chain Cs； PDBConstruct 1–377； UniProt 1–377 Author chain Ct； PDBConstruct 1–377； UniProt 1–377 Author chain Cu； PDBConstruct 1–377； UniProt 1–377 Author chain Cv； PDBConstruct 1–377； UniProt 1–377 Author chain Cw； PDBConstruct 1–377； UniProt 1–377 Author chain Cx； PDBConstruct 1–377； UniProt 1–377 Author chain Cy； PDBConstruct 1–377； UniProt 1–377 Author chain Cz； PDBConstruct 1–377； UniProt 1–377

Sodium-type flagellar protein MotY

OrganismNot specified

UniProt Q9KT95

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 182 PDB declaration: 182-meric（182） Consistent with protein copy count	Chain Da； UniProt 1–294 Chain Db； UniProt 1–294 Chain Dc； UniProt 1–294 Chain Dd； UniProt 1–294 Chain De； UniProt 1–294 Chain Df； UniProt 1–294 Chain Dg； UniProt 1–294 Chain Dh； UniProt 1–294 Chain Di； UniProt 1–294 Chain Dj； UniProt 1–294 Chain Dk； UniProt 1–294 Chain Dl； UniProt 1–294 Chain Dm； UniProt 1–294 Chain Dn； UniProt 1–294 Chain Do； UniProt 1–294 Chain Dp； UniProt 1–294 Chain Dq； UniProt 1–294 Chain Dr； UniProt 1–294 Chain Ds； UniProt 1–294 Chain Dt； UniProt 1–294 Chain Du； UniProt 1–294 Chain Dv； UniProt 1–294 Chain Dw； UniProt 1–294 Chain Dx； UniProt 1–294 Chain Dy； UniProt 1–294 Chain Dz； UniProt 1–294	Not recorded	Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotX × 26 （Q9KNX9） Lipoprotein × 52 （Q9KQ01）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.57 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9YEC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YDO LPHT-ring in Vibrio cholerae at assembled, opened state Deposited 2025-09-22	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Da 23–294（272 aa） Chain Db 23–294（272 aa） Chain Dc 23–294（272 aa） Chain Dd 23–294（272 aa） Chain De 23–294（272 aa） Chain Df 23–294（272 aa） Chain Dg 23–294（272 aa） Chain Dh 23–294（272 aa） Chain Di 23–294（272 aa） Chain Dj 23–294（272 aa） Chain Dk 23–294（272 aa） Chain Dl 23–294（272 aa） Chain Dm 23–294（272 aa） Chain Dn 23–294（272 aa） Chain Do 23–294（272 aa） Chain Dp 23–294（272 aa） Chain Dq 23–294（272 aa） Chain Dr 23–294（272 aa） Chain Ds 23–294（272 aa） Chain Dt 23–294（272 aa） Chain Du 23–294（272 aa） Chain Dv 23–294（272 aa） Chain Dw 23–294（272 aa） Chain Dx 23–294（272 aa） Chain Dy 23–294（272 aa） Chain Dz 23–294（272 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.69 Å
9YDT LPHT-ring in Vibrio cholerae at disassembled, closed state Deposited 2025-09-23	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 156 PDB declaration: 156-meric	Chain Da 23–294（272 aa） Chain Db 23–294（272 aa） Chain Dc 23–294（272 aa） Chain Dd 23–294（272 aa） Chain De 23–294（272 aa） Chain Df 23–294（272 aa） Chain Dg 23–294（272 aa） Chain Dh 23–294（272 aa） Chain Di 23–294（272 aa） Chain Dj 23–294（272 aa） Chain Dk 23–294（272 aa） Chain Dl 23–294（272 aa） Chain Dm 23–294（272 aa） Chain Dn 23–294（272 aa） Chain Do 23–294（272 aa） Chain Dp 23–294（272 aa） Chain Dq 23–294（272 aa） Chain Dr 23–294（272 aa） Chain Ds 23–294（272 aa） Chain Dt 23–294（272 aa） Chain Du 23–294（272 aa） Chain Dv 23–294（272 aa） Chain Dw 23–294（272 aa） Chain Dx 23–294（272 aa） Chain Dy 23–294（272 aa） Chain Dz 23–294（272 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.75 Å
9YED T-ring-PomB complex in Vibrio cholerae Deposited 2025-09-24	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain BP1 23–294（272 aa） Chain FP1 23–294（272 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 4.98 Å
9YFG Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state Deposited 2025-09-25	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 298 PDB declaration: 298-meric	Chain Da 23–293（271 aa） Chain Db 23–293（271 aa） Chain Dc 23–293（271 aa） Chain Dd 23–293（271 aa） Chain De 23–293（271 aa） Chain Df 23–293（271 aa） Chain Dg 23–293（271 aa） Chain Dh 23–293（271 aa） Chain Di 23–293（271 aa） Chain Dj 23–293（271 aa） Chain Dk 23–293（271 aa） Chain Dl 23–293（271 aa） Chain Dm 23–293（271 aa） Chain Dn 23–293（271 aa） Chain Do 23–293（271 aa） Chain Dp 23–293（271 aa） Chain Dq 23–293（271 aa） Chain Dr 23–293（271 aa） Chain Ds 23–293（271 aa） Chain Dt 23–293（271 aa） Chain Du 23–293（271 aa） Chain Dv 23–293（271 aa） Chain Dw 23–293（271 aa） Chain Dx 23–293（271 aa） Chain Dy 23–293（271 aa） Chain Dz 23–293（271 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.55 Å
9YH0 LPHT-ring subunit with C13 MotX in Vibrio cholerae at assembled state Deposited 2025-09-29	Different construct Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Da 23–294（272 aa） Chain Db 23–294（272 aa） Chain Dc 23–294（272 aa） Chain Dd 23–294（272 aa） Chain De 23–294（272 aa） Chain Df 23–294（272 aa） Chain Dg 23–294（272 aa） Chain Dh 23–294（272 aa） Chain Di 23–294（272 aa） Chain Dj 23–294（272 aa） Chain Dk 23–294（272 aa） Chain Dl 23–294（272 aa） Chain Dm 23–294（272 aa） Chain Dn 23–294（272 aa） Chain Do 23–294（272 aa） Chain Dp 23–294（272 aa） Chain Dq 23–294（272 aa） Chain Dr 23–294（272 aa） Chain Ds 23–294（272 aa） Chain Dt 23–294（272 aa） Chain Du 23–294（272 aa） Chain Dv 23–294（272 aa） Chain Dw 23–294（272 aa） Chain Dx 23–294（272 aa） Chain Dy 23–294（272 aa） Chain Dz 23–294（272 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Ex 23–293（271 aa） Chain Ey 23–293（271 aa） Chain Ez 23–293（271 aa） Chain Fa 23–293（271 aa） Chain Fb 23–293（271 aa） Chain Fc 23–293（271 aa） Chain Fd 23–293（271 aa） Chain Fe 23–293（271 aa） Chain Ff 23–293（271 aa） Chain Fg 23–293（271 aa） Chain Fh 23–293（271 aa） Chain Fi 23–293（271 aa） Chain Fj 23–293（271 aa） Chain Fk 23–293（271 aa） Chain Fl 23–293（271 aa） Chain Fm 23–293（271 aa） Chain Fn 23–293（271 aa） Chain Fo 23–293（271 aa） Chain Fp 23–293（271 aa） Chain Fq 23–293（271 aa） Chain Fr 23–293（271 aa） Chain Fs 23–293（271 aa） Chain Ft 23–293（271 aa） Chain Fu 23–293（271 aa） Chain Fv 23–293（271 aa） Chain Fw 23–293（271 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH7 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a higher FOMC conformation Deposited 2025-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Ex 23–293（271 aa） Chain Ey 23–293（271 aa） Chain Ez 23–293（271 aa） Chain Fa 23–293（271 aa） Chain Fb 23–293（271 aa） Chain Fc 23–293（271 aa） Chain Fd 23–293（271 aa） Chain Fe 23–293（271 aa） Chain Ff 23–293（271 aa） Chain Fg 23–293（271 aa） Chain Fh 23–293（271 aa） Chain Fi 23–293（271 aa） Chain Fj 23–293（271 aa） Chain Fk 23–293（271 aa） Chain Fl 23–293（271 aa） Chain Fm 23–293（271 aa） Chain Fn 23–293（271 aa） Chain Fo 23–293（271 aa） Chain Fp 23–293（271 aa） Chain Fq 23–293（271 aa） Chain Fr 23–293（271 aa） Chain Fs 23–293（271 aa） Chain Ft 23–293（271 aa） Chain Fu 23–293（271 aa） Chain Fv 23–293（271 aa） Chain Fw 23–293（271 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9KT95_VIBCH
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Da； PDBConstruct 1–294； UniProt 1–294 Author chain Db； PDBConstruct 1–294； UniProt 1–294 Author chain Dc； PDBConstruct 1–294； UniProt 1–294 Author chain Dd； PDBConstruct 1–294； UniProt 1–294 Author chain De； PDBConstruct 1–294； UniProt 1–294 Author chain Df； PDBConstruct 1–294； UniProt 1–294 Author chain Dg； PDBConstruct 1–294； UniProt 1–294 Author chain Dh； PDBConstruct 1–294； UniProt 1–294 Author chain Di； PDBConstruct 1–294； UniProt 1–294 Author chain Dj； PDBConstruct 1–294； UniProt 1–294 Author chain Dk； PDBConstruct 1–294； UniProt 1–294 Author chain Dl； PDBConstruct 1–294； UniProt 1–294 Author chain Dm； PDBConstruct 1–294； UniProt 1–294 Author chain Dn； PDBConstruct 1–294； UniProt 1–294 Author chain Do； PDBConstruct 1–294； UniProt 1–294 Author chain Dp； PDBConstruct 1–294； UniProt 1–294 Author chain Dq； PDBConstruct 1–294； UniProt 1–294 Author chain Dr； PDBConstruct 1–294； UniProt 1–294 Author chain Ds； PDBConstruct 1–294； UniProt 1–294 Author chain Dt； PDBConstruct 1–294； UniProt 1–294 Author chain Du； PDBConstruct 1–294； UniProt 1–294 Author chain Dv； PDBConstruct 1–294； UniProt 1–294 Author chain Dw； PDBConstruct 1–294； UniProt 1–294 Author chain Dx； PDBConstruct 1–294； UniProt 1–294 Author chain Dy； PDBConstruct 1–294； UniProt 1–294 Author chain Dz； PDBConstruct 1–294； UniProt 1–294

Sodium-type flagellar protein MotX

OrganismNot specified

UniProt Q9KNX9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 182 PDB declaration: 182-meric（182） Consistent with protein copy count	Chain Ea； UniProt 1–211 Chain Eb； UniProt 1–211 Chain Ec； UniProt 1–211 Chain Ed； UniProt 1–211 Chain Ee； UniProt 1–211 Chain Ef； UniProt 1–211 Chain Eg； UniProt 1–211 Chain Eh； UniProt 1–211 Chain Ei； UniProt 1–211 Chain Ej； UniProt 1–211 Chain Ek； UniProt 1–211 Chain El； UniProt 1–211 Chain Em； UniProt 1–211 Chain En； UniProt 1–211 Chain Eo； UniProt 1–211 Chain Ep； UniProt 1–211 Chain Eq； UniProt 1–211 Chain Er； UniProt 1–211 Chain Es； UniProt 1–211 Chain Et； UniProt 1–211 Chain Eu； UniProt 1–211 Chain Ev； UniProt 1–211 Chain Ew； UniProt 1–211 Chain Ex； UniProt 1–211 Chain Ey； UniProt 1–211 Chain Ez； UniProt 1–211	Not recorded	Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Lipoprotein × 52 （Q9KQ01）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.57 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9YEC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YED T-ring-PomB complex in Vibrio cholerae Deposited 2025-09-24	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain AP1 24–211（188 aa） Chain EP1 24–211（188 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 4.98 Å
9YFG Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state Deposited 2025-09-25	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 298 PDB declaration: 298-meric	Chain Ea 29–211（183 aa） Chain Eb 29–211（183 aa） Chain Ec 29–211（183 aa） Chain Ed 29–211（183 aa） Chain Ee 29–211（183 aa） Chain Ef 29–211（183 aa） Chain Eg 29–211（183 aa） Chain Eh 29–211（183 aa） Chain Ei 29–211（183 aa） Chain Ej 29–211（183 aa） Chain Ek 29–211（183 aa） Chain El 29–211（183 aa） Chain Em 29–211（183 aa） Chain En 29–211（183 aa） Chain Eo 29–211（183 aa） Chain Ep 29–211（183 aa） Chain Eq 29–211（183 aa） Chain Er 29–211（183 aa） Chain Es 29–211（183 aa） Chain Et 29–211（183 aa） Chain Eu 29–211（183 aa） Chain Ev 29–211（183 aa） Chain Ew 29–211（183 aa） Chain Ex 29–211（183 aa） Chain Ey 29–211（183 aa） Chain Ez 29–211（183 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.55 Å
9YH0 LPHT-ring subunit with C13 MotX in Vibrio cholerae at assembled state Deposited 2025-09-29	Different construct Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 182 PDB declaration: 182-meric	Chain Ea 24–211（188 aa） Chain Eb 24–211（188 aa） Chain Ec 24–211（188 aa） Chain Ed 24–211（188 aa） Chain Ee 24–211（188 aa） Chain Ef 24–211（188 aa） Chain Eg 24–211（188 aa） Chain Eh 24–211（188 aa） Chain Ei 24–211（188 aa） Chain Ej 24–211（188 aa） Chain Ek 24–211（188 aa） Chain El 24–211（188 aa） Chain Em 24–211（188 aa） Chain En 24–211（188 aa） Chain Eo 24–211（188 aa） Chain Ep 24–211（188 aa） Chain Eq 24–211（188 aa） Chain Er 24–211（188 aa） Chain Es 24–211（188 aa） Chain Et 24–211（188 aa） Chain Eu 24–211（188 aa） Chain Ev 24–211（188 aa） Chain Ew 24–211（188 aa） Chain Ex 24–211（188 aa） Chain Ey 24–211（188 aa） Chain Ez 24–211（188 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Fx 29–211（183 aa） Chain Fy 29–211（183 aa） Chain Fz 29–211（183 aa） Chain Ga 29–211（183 aa） Chain Gb 29–211（183 aa） Chain Gc 29–211（183 aa） Chain Gd 29–211（183 aa） Chain Ge 29–211（183 aa） Chain Gf 29–211（183 aa） Chain Gg 29–211（183 aa） Chain Gh 29–211（183 aa） Chain Gi 29–211（183 aa） Chain Gj 29–211（183 aa） Chain Gk 29–211（183 aa） Chain Gl 29–211（183 aa） Chain Gm 29–211（183 aa） Chain Gn 29–211（183 aa） Chain Go 29–211（183 aa） Chain Gp 29–211（183 aa） Chain Gq 29–211（183 aa） Chain Gr 29–211（183 aa） Chain Gs 29–211（183 aa） Chain Gt 29–211（183 aa） Chain Gu 29–211（183 aa） Chain Gv 29–211（183 aa） Chain Gw 29–211（183 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH7 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a higher FOMC conformation Deposited 2025-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Fx 29–211（183 aa） Chain Fy 29–211（183 aa） Chain Fz 29–211（183 aa） Chain Ga 29–211（183 aa） Chain Gb 29–211（183 aa） Chain Gc 29–211（183 aa） Chain Gd 29–211（183 aa） Chain Ge 29–211（183 aa） Chain Gf 29–211（183 aa） Chain Gg 29–211（183 aa） Chain Gh 29–211（183 aa） Chain Gi 29–211（183 aa） Chain Gj 29–211（183 aa） Chain Gk 29–211（183 aa） Chain Gl 29–211（183 aa） Chain Gm 29–211（183 aa） Chain Gn 29–211（183 aa） Chain Go 29–211（183 aa） Chain Gp 29–211（183 aa） Chain Gq 29–211（183 aa） Chain Gr 29–211（183 aa） Chain Gs 29–211（183 aa） Chain Gt 29–211（183 aa） Chain Gu 29–211（183 aa） Chain Gv 29–211（183 aa） Chain Gw 29–211（183 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9KNX9_VIBCH
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain Ea； PDBConstruct 1–211； UniProt 1–211 Author chain Eb； PDBConstruct 1–211； UniProt 1–211 Author chain Ec； PDBConstruct 1–211； UniProt 1–211 Author chain Ed； PDBConstruct 1–211； UniProt 1–211 Author chain Ee； PDBConstruct 1–211； UniProt 1–211 Author chain Ef； PDBConstruct 1–211； UniProt 1–211 Author chain Eg； PDBConstruct 1–211； UniProt 1–211 Author chain Eh； PDBConstruct 1–211； UniProt 1–211 Author chain Ei； PDBConstruct 1–211； UniProt 1–211 Author chain Ej； PDBConstruct 1–211； UniProt 1–211 Author chain Ek； PDBConstruct 1–211； UniProt 1–211 Author chain El； PDBConstruct 1–211； UniProt 1–211 Author chain Em； PDBConstruct 1–211； UniProt 1–211 Author chain En； PDBConstruct 1–211； UniProt 1–211 Author chain Eo； PDBConstruct 1–211； UniProt 1–211 Author chain Ep； PDBConstruct 1–211； UniProt 1–211 Author chain Eq； PDBConstruct 1–211； UniProt 1–211 Author chain Er； PDBConstruct 1–211； UniProt 1–211 Author chain Es； PDBConstruct 1–211； UniProt 1–211 Author chain Et； PDBConstruct 1–211； UniProt 1–211 Author chain Eu； PDBConstruct 1–211； UniProt 1–211 Author chain Ev； PDBConstruct 1–211； UniProt 1–211 Author chain Ew； PDBConstruct 1–211； UniProt 1–211 Author chain Ex； PDBConstruct 1–211； UniProt 1–211 Author chain Ey； PDBConstruct 1–211； UniProt 1–211 Author chain Ez； PDBConstruct 1–211； UniProt 1–211

Lipoprotein

OrganismNot specified

UniProt Q9KQ01

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 182 PDB declaration: 182-meric（182） Consistent with protein copy count	Chain Fa； UniProt 1–145 Chain Fb； UniProt 1–145 Chain Fc； UniProt 1–145 Chain Fd； UniProt 1–145 Chain Fe； UniProt 1–145 Chain Ff； UniProt 1–145 Chain Fg； UniProt 1–145 Chain Fh； UniProt 1–145 Chain Fi； UniProt 1–145 Chain Fj； UniProt 1–145 Chain Fk； UniProt 1–145 Chain Fl； UniProt 1–145 Chain Fm； UniProt 1–145 Chain Fn； UniProt 1–145 Chain Fo； UniProt 1–145 Chain Fp； UniProt 1–145 Chain Fq； UniProt 1–145 Chain Fr； UniProt 1–145 Chain Fs； UniProt 1–145 Chain Ft； UniProt 1–145 Chain Fu； UniProt 1–145 Chain Fv； UniProt 1–145 Chain Fw； UniProt 1–145 Chain Fx； UniProt 1–145 Chain Fy； UniProt 1–145 Chain Fz； UniProt 1–145 Chain Ga； UniProt 1–145 Chain Gb； UniProt 1–145 Chain Gc； UniProt 1–145 Chain Gd； UniProt 1–145 Chain Ge； UniProt 1–145 Chain Gf； UniProt 1–145 Chain Gg； UniProt 1–145 Chain Gh； UniProt 1–145 Chain Gi； UniProt 1–145 Chain Gj； UniProt 1–145 Chain Gk； UniProt 1–145 Chain Gl； UniProt 1–145 Chain Gm； UniProt 1–145 Chain Gn； UniProt 1–145 Chain Go； UniProt 1–145 Chain Gp； UniProt 1–145 Chain Gq； UniProt 1–145 Chain Gr； UniProt 1–145 Chain Gs； UniProt 1–145 Chain Gt； UniProt 1–145 Chain Gu； UniProt 1–145 Chain Gv； UniProt 1–145 Chain Gw； UniProt 1–145 Chain Gx； UniProt 1–145 Chain Gy； UniProt 1–145 Chain Gz； UniProt 1–145	Not recorded	Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.57 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9YEC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YDS H-ring subunit FlgO and FlgP in Vibrio cholerae at assembled, opened state Deposited 2025-09-23	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 116 PDB declaration: 116-meric	Chain Aa 26–130（105 aa） Chain Ac 26–130（105 aa） Chain Ae 26–130（105 aa） Chain Ag 26–130（105 aa） Chain Ai 26–130（105 aa） Chain Ak 26–130（105 aa） Chain Am 26–130（105 aa） Chain Ao 26–130（105 aa） Chain Aq 26–130（105 aa） Chain As 26–130（105 aa） Chain Au 26–130（105 aa） Chain Aw 26–130（105 aa） Chain Ay 26–130（105 aa） Chain Ba 26–130（105 aa） Chain Bc 26–130（105 aa） Chain Be 26–130（105 aa） Chain Bg 26–130（105 aa） Chain Bi 26–130（105 aa） Chain Bk 26–130（105 aa） Chain Bm 26–130（105 aa） Chain Bo 26–130（105 aa） Chain Bq 26–130（105 aa） Chain Bs 26–130（105 aa） Chain Bu 26–130（105 aa） Chain Bw 26–130（105 aa） Chain By 26–130（105 aa） Chain Ca 26–130（105 aa） Chain Cc 26–130（105 aa） Chain Ce 26–130（105 aa） Chain Cg 26–130（105 aa） Chain Ci 26–130（105 aa） Chain Ck 26–130（105 aa） Chain Cm 26–130（105 aa） Chain Co 26–130（105 aa） Chain Cq 26–130（105 aa） Chain Cs 26–130（105 aa） Chain Cu 26–130（105 aa） Chain Cw 26–130（105 aa） Chain Cy 26–130（105 aa） Chain Da 26–130（105 aa） Chain Dc 26–130（105 aa） Chain De 26–130（105 aa） Chain Dg 26–130（105 aa） Chain Di 26–130（105 aa） Chain Dk 26–130（105 aa） Chain Dm 26–130（105 aa） Chain Do 26–130（105 aa） Chain Dq 26–130（105 aa） Chain Ds 26–130（105 aa） Chain Du 26–130（105 aa） Chain Dw 26–130（105 aa） Chain Dy 26–130（105 aa） Chain Ea 26–130（105 aa） Chain Ec 26–130（105 aa） Chain Ee 26–130（105 aa） Chain Eg 26–130（105 aa） Chain Ei 26–130（105 aa） Chain Ek 26–130（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.45 Å
9YFG Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state Deposited 2025-09-25	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 298 PDB declaration: 298-meric	Chain Ha 26–130（105 aa） Chain Hc 26–130（105 aa） Chain He 26–130（105 aa） Chain Hg 26–130（105 aa） Chain Hi 26–130（105 aa） Chain Hk 26–130（105 aa） Chain Hm 26–130（105 aa） Chain Ho 26–130（105 aa） Chain Hq 26–130（105 aa） Chain Hs 26–130（105 aa） Chain Hu 26–130（105 aa） Chain Hw 26–130（105 aa） Chain Hy 26–130（105 aa） Chain Ia 26–130（105 aa） Chain Ic 26–130（105 aa） Chain Ie 26–130（105 aa） Chain Ig 26–130（105 aa） Chain Ii 26–130（105 aa） Chain Ik 26–130（105 aa） Chain Im 26–130（105 aa） Chain Io 26–130（105 aa） Chain Iq 26–130（105 aa） Chain Is 26–130（105 aa） Chain Iu 26–130（105 aa） Chain Iw 26–130（105 aa） Chain Iy 26–130（105 aa） Chain Ja 26–130（105 aa） Chain Jc 26–130（105 aa） Chain Je 26–130（105 aa） Chain Jg 26–130（105 aa） Chain Ji 26–130（105 aa） Chain Jk 26–130（105 aa） Chain Jm 26–130（105 aa） Chain Jo 26–130（105 aa） Chain Jq 26–130（105 aa） Chain Js 26–130（105 aa） Chain Ju 26–130（105 aa） Chain Jw 26–130（105 aa） Chain Jy 26–130（105 aa） Chain Ka 26–130（105 aa） Chain Kc 26–130（105 aa） Chain Ke 26–130（105 aa） Chain Kg 26–130（105 aa） Chain Ki 26–130（105 aa） Chain Kk 26–130（105 aa） Chain Km 26–130（105 aa） Chain Ko 26–130（105 aa） Chain Kq 26–130（105 aa） Chain Ks 26–130（105 aa） Chain Ku 26–130（105 aa） Chain Kw 26–130（105 aa） Chain Ky 26–130（105 aa） Chain La 26–130（105 aa） Chain Lc 26–130（105 aa） Chain Le 26–130（105 aa） Chain Lg 26–130（105 aa） Chain Li 26–130（105 aa） Chain Lk 26–130（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.55 Å
9YH6 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a lower FOMC conformation Deposited 2025-09-30	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Jx 26–130（105 aa） Chain Jy 26–130（105 aa） Chain Jz 26–130（105 aa） Chain Ka 26–130（105 aa） Chain Kb 26–130（105 aa） Chain Kc 26–130（105 aa） Chain Kd 26–130（105 aa） Chain Ke 26–130（105 aa） Chain Kf 26–130（105 aa） Chain Kg 26–130（105 aa） Chain Kh 26–130（105 aa） Chain Ki 26–130（105 aa） Chain Kj 26–130（105 aa） Chain Kk 26–130（105 aa） Chain Kl 26–130（105 aa） Chain Km 26–130（105 aa） Chain Kn 26–130（105 aa） Chain Ko 26–130（105 aa） Chain Kp 26–130（105 aa） Chain Kq 26–130（105 aa） Chain Kr 26–130（105 aa） Chain Ks 26–130（105 aa） Chain Kt 26–130（105 aa） Chain Ku 26–130（105 aa） Chain Kv 26–130（105 aa） Chain Kw 26–130（105 aa） Chain Kx 26–130（105 aa） Chain Ky 26–130（105 aa） Chain Kz 26–130（105 aa） Chain La 26–130（105 aa） Chain Lb 26–130（105 aa） Chain Lc 26–130（105 aa） Chain Ld 26–130（105 aa） Chain Le 26–130（105 aa） Chain Lf 26–130（105 aa） Chain Lg 26–130（105 aa） Chain Lh 26–130（105 aa） Chain Li 26–130（105 aa） Chain Lj 26–130（105 aa） Chain Lk 26–130（105 aa） Chain Ll 26–130（105 aa） Chain Lm 26–130（105 aa） Chain Ln 26–130（105 aa） Chain Lo 26–130（105 aa） Chain Lp 26–130（105 aa） Chain Lq 26–130（105 aa） Chain Lr 26–130（105 aa） Chain Ls 26–130（105 aa） Chain Lt 26–130（105 aa） Chain Lu 26–130（105 aa） Chain Lv 26–130（105 aa） Chain Lw 26–130（105 aa） Chain Lx 26–130（105 aa） Chain Ly 26–130（105 aa） Chain Lz 26–130（105 aa） Chain Ma 26–130（105 aa） Chain Mb 26–130（105 aa） Chain Mc 26–130（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å
9YH7 Composite structure of the sheathed flagellar motor in Vibrio cholerae adopting a higher FOMC conformation Deposited 2025-09-30	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 407 PDB declaration: 407-meric	Chain Gx 134–145（12 aa） Chain Gy 134–145（12 aa） Chain Gz 134–145（12 aa） Chain Ha 134–145（12 aa） Chain Hb 134–145（12 aa） Chain Hc 134–145（12 aa） Chain Hd 134–145（12 aa） Chain He 134–145（12 aa） Chain Hf 134–145（12 aa） Chain Hg 134–145（12 aa） Chain Hh 134–145（12 aa） Chain Hi 134–145（12 aa） Chain Hj 134–145（12 aa） Chain Hk 134–145（12 aa） Chain Hl 134–145（12 aa） Chain Hm 134–145（12 aa） Chain Hn 134–145（12 aa） Chain Ho 134–145（12 aa） Chain Hp 134–145（12 aa） Chain Hq 134–145（12 aa） Chain Hr 134–145（12 aa） Chain Hs 134–145（12 aa） Chain Ht 134–145（12 aa） Chain Hu 134–145（12 aa） Chain Hv 134–145（12 aa） Chain Hw 134–145（12 aa） Chain Hx 134–145（12 aa） Chain Hy 134–145（12 aa） Chain Hz 134–145（12 aa） Chain Ia 134–145（12 aa） Chain Ib 134–145（12 aa） Chain Ic 134–145（12 aa） Chain Id 134–145（12 aa） Chain Ie 134–145（12 aa） Chain If 134–145（12 aa） Chain Ig 134–145（12 aa） Chain Ih 134–145（12 aa） Chain Ii 134–145（12 aa） Chain Ij 134–145（12 aa） Chain Ik 134–145（12 aa） Chain Il 134–145（12 aa） Chain Im 134–145（12 aa） Chain In 134–145（12 aa） Chain Io 134–145（12 aa） Chain Ip 134–145（12 aa） Chain Iq 134–145（12 aa） Chain Ir 134–145（12 aa） Chain Is 134–145（12 aa） Chain It 134–145（12 aa） Chain Iu 134–145（12 aa） Chain Iv 134–145（12 aa） Chain Iw 134–145（12 aa） Chain Jx 26–130（105 aa） Chain Jy 26–130（105 aa） Chain Jz 26–130（105 aa） Chain Ka 26–130（105 aa） Chain Kb 26–130（105 aa） Chain Kc 26–130（105 aa） Chain Kd 26–130（105 aa） Chain Ke 26–130（105 aa） Chain Kf 26–130（105 aa） Chain Kg 26–130（105 aa） Chain Kh 26–130（105 aa） Chain Ki 26–130（105 aa） Chain Kj 26–130（105 aa） Chain Kk 26–130（105 aa） Chain Kl 26–130（105 aa） Chain Km 26–130（105 aa） Chain Kn 26–130（105 aa） Chain Ko 26–130（105 aa） Chain Kp 26–130（105 aa） Chain Kq 26–130（105 aa） Chain Kr 26–130（105 aa） Chain Ks 26–130（105 aa） Chain Kt 26–130（105 aa） Chain Ku 26–130（105 aa） Chain Kv 26–130（105 aa） Chain Kw 26–130（105 aa） Chain Kx 26–130（105 aa） Chain Ky 26–130（105 aa） Chain Kz 26–130（105 aa） Chain La 26–130（105 aa） Chain Lb 26–130（105 aa） Chain Lc 26–130（105 aa） Chain Ld 26–130（105 aa） Chain Le 26–130（105 aa） Chain Lf 26–130（105 aa） Chain Lg 26–130（105 aa） Chain Lh 26–130（105 aa） Chain Li 26–130（105 aa） Chain Lj 26–130（105 aa） Chain Lk 26–130（105 aa） Chain Ll 26–130（105 aa） Chain Lm 26–130（105 aa） Chain Ln 26–130（105 aa） Chain Lo 26–130（105 aa） Chain Lp 26–130（105 aa） Chain Lq 26–130（105 aa） Chain Lr 26–130（105 aa） Chain Ls 26–130（105 aa） Chain Lt 26–130（105 aa） Chain Lu 26–130（105 aa） Chain Lv 26–130（105 aa） Chain Lw 26–130（105 aa） Chain Lx 26–130（105 aa） Chain Ly 26–130（105 aa） Chain Lz 26–130（105 aa） Chain Ma 26–130（105 aa） Chain Mb 26–130（105 aa） Chain Mc 26–130（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.60 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9KQ01_VIBCH
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain Fa； PDBConstruct 1–145； UniProt 1–145 Author chain Fb； PDBConstruct 1–145； UniProt 1–145 Author chain Fc； PDBConstruct 1–145； UniProt 1–145 Author chain Fd； PDBConstruct 1–145； UniProt 1–145 Author chain Fe； PDBConstruct 1–145； UniProt 1–145 Author chain Ff； PDBConstruct 1–145； UniProt 1–145 Author chain Fg； PDBConstruct 1–145； UniProt 1–145 Author chain Fh； PDBConstruct 1–145； UniProt 1–145 Author chain Fi； PDBConstruct 1–145； UniProt 1–145 Author chain Fj； PDBConstruct 1–145； UniProt 1–145 Author chain Fk； PDBConstruct 1–145； UniProt 1–145 Author chain Fl； PDBConstruct 1–145； UniProt 1–145 Author chain Fm； PDBConstruct 1–145； UniProt 1–145 Author chain Fn； PDBConstruct 1–145； UniProt 1–145 Author chain Fo； PDBConstruct 1–145； UniProt 1–145 Author chain Fp； PDBConstruct 1–145； UniProt 1–145 Author chain Fq； PDBConstruct 1–145； UniProt 1–145 Author chain Fr； PDBConstruct 1–145； UniProt 1–145 Author chain Fs； PDBConstruct 1–145； UniProt 1–145 Author chain Ft； PDBConstruct 1–145； UniProt 1–145 Author chain Fu； PDBConstruct 1–145； UniProt 1–145 Author chain Fv； PDBConstruct 1–145； UniProt 1–145 Author chain Fw； PDBConstruct 1–145； UniProt 1–145 Author chain Fx； PDBConstruct 1–145； UniProt 1–145 Author chain Fy； PDBConstruct 1–145； UniProt 1–145 Author chain Fz； PDBConstruct 1–145； UniProt 1–145 Author chain Ga； PDBConstruct 1–145； UniProt 1–145 Author chain Gb； PDBConstruct 1–145； UniProt 1–145 Author chain Gc； PDBConstruct 1–145； UniProt 1–145 Author chain Gd； PDBConstruct 1–145； UniProt 1–145 Author chain Ge； PDBConstruct 1–145； UniProt 1–145 Author chain Gf； PDBConstruct 1–145； UniProt 1–145 Author chain Gg； PDBConstruct 1–145； UniProt 1–145 Author chain Gh； PDBConstruct 1–145； UniProt 1–145 Author chain Gi； PDBConstruct 1–145； UniProt 1–145 Author chain Gj； PDBConstruct 1–145； UniProt 1–145 Author chain Gk； PDBConstruct 1–145； UniProt 1–145 Author chain Gl； PDBConstruct 1–145； UniProt 1–145 Author chain Gm； PDBConstruct 1–145； UniProt 1–145 Author chain Gn； PDBConstruct 1–145； UniProt 1–145 Author chain Go； PDBConstruct 1–145； UniProt 1–145 Author chain Gp； PDBConstruct 1–145； UniProt 1–145 Author chain Gq； PDBConstruct 1–145； UniProt 1–145 Author chain Gr； PDBConstruct 1–145； UniProt 1–145 Author chain Gs； PDBConstruct 1–145； UniProt 1–145 Author chain Gt； PDBConstruct 1–145； UniProt 1–145 Author chain Gu； PDBConstruct 1–145； UniProt 1–145 Author chain Gv； PDBConstruct 1–145； UniProt 1–145 Author chain Gw； PDBConstruct 1–145； UniProt 1–145 Author chain Gx； PDBConstruct 1–145； UniProt 1–145 Author chain Gy； PDBConstruct 1–145； UniProt 1–145 Author chain Gz； PDBConstruct 1–145； UniProt 1–145

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9yec
Deposition date deposition_date	2025-09-24
Structure title title	LPHT-ring in Vibrio cholerae at disassembled, closed state
Keywords keywords	In situ cryo-EM, sheathed flagellar motor, Vibrio cholerae, T-ring, MotX, C26 assembled state, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	— Å
Radius of gyration Rg (electron density) rg_electron	128.80 Å
Forward intensity I(0) i0	220129000000.00
Molecular weight molecular_weight	3972000.0 kDa
Excluded volume excluded_volume	4951400 Å³
Envelope volume envelope_volume	8883700 Å³
Hydration-shell volume shell_volume	530380 Å³
Envelope diameter envelope_diameter	388.8 Å
Shell Rg shell_rg	145.50 Å
Envelope Rg envelope_rg	124.20 Å
Shape Rg shape_rg	128.90 Å
Total Rg total_rg	128.70 Å
Total atoms total_atoms	279357
Residues n_residues	36049
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	314.9 Å
Rg (real space) rg_real	125.30 Å
Rg uncertainty (real space) rg_real_error	0.76 Å
I(0) (real space) i0_real	2.1180e+11
I(0) uncertainty (real space) i0_real_error	4.3930e+09
Rg (reciprocal space) rg_reciprocal	129.30 Å
I(0) (reciprocal space) i0_reciprocal	219000000000.0000
Solution quality estimate total_estimate	0.9118
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	183.7 Å
Skewness Skewness skewness	-0.015
Kurtosis Kurtosis kurtosis	-0.854
Angular range angular_range	— – 0.0600 Å⁻¹
Current regularization parameter α current_alpha	0.4620
Highest regularization parameter α highest_alpha	7936000000.0000
Real-space data points n_real_points	13
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.999; Stabil: 0.978; Sysdev: 1.000; Positv: 1.000; Valcen: 0.924; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Flagellar L-ring protein
Molecular weight formula_weight	27541.5 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa,Ab,Ac,Ad,Ae,Af,Ag,Ah,Ai,Aj,Ak,Al,Am,An,Ao,Ap,Aq,Ar,As,At,Au,Av,Aw,Ax,Ay,Az
Atom count atom_count	279357

MKRLLASSLLILLSGCSLMQPPIESAETIQGTTTVDAVEGDKSESNSGLTDALRNRTDPVAGDPAWAPIHPKGKPEHYAAETGSLFNLASSSSMYDDSKPRGVGDIITVTLNESTKAAKSADADLNKKNDASMDPLAVGGKDLTIGDYNFSYALKNDNKFSGSAAANQSNSMSGSITVEVIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEPGFLARFFNVSL

Entity 2 Entity 2 polymer

Description description	Flagellar P-ring protein
Molecular weight formula_weight	37694.1 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ba,Bb,Bc,Bd,Be,Bf,Bg,Bh,Bi,Bj,Bk,Bl,Bm,Bn,Bo,Bp,Bq,Br,Bs,Bt,Bu,Bv,Bw,Bx,By,Bz

MRKFTILLMLLLASSAQAARIKDVAQVAGVRNNQLVGYGLVTGLPGTGESTPFTDQSFNAMLQSFGIQLPPGTKPKTKNVAAVIVTADLPAFSKQGQTIDITVSSIGSAKSLRGGTLMQTFLKGLDGQVYAVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGDYITFNLFESDFTTAQRLADAVNQFLGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENLEFNPADSAAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNALGGGQTVVVPNTEIEVTEKQGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLIII

Entity 3 Entity 3 polymer

Description description	Flagellar protein FlgT
Molecular weight formula_weight	42647.7 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ca,Cb,Cc,Cd,Ce,Cf,Cg,Ch,Ci,Cj,Ck,Cl,Cm,Cn,Co,Cp,Cq,Cr,Cs,Ct,Cu,Cv,Cw,Cx,Cy,Cz

MKKNILSIISALWMMLQLPSAHAAWYEVTGSAAIVSSEEVARLHALEDALYKAVNFAGADIGSISNLMPLLESDRREYLFANHEVRYILIEERKAINNVMYVRTRIDIYPSATACHVEQYKKTMLIGNIDLASPQQAVMGQIYQVGDDFAQVINRRLEQESRSFVSVGTTQYDIDPKAPERIKMIAQDAGAQYIMGGMITDLTATIEQKTLQDDIINRQFAMEISVFDGKTGNEVMTRTYREVARWPFPKTSQIDTRSARFWASTYGEMMLRVSRNIMLDLESEISCKITLPQIVAKFGTTATMDLGRIHGVKQGDKLSLWHTGAFIDQQGLPRNKVTQSEITLTVSRVYEHEAELTVDQPELAYSIQIGDVMHKQM

Entity 4 Entity 4 polymer

Description description	Sodium-type flagellar protein MotY
Molecular weight formula_weight	33587.7 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Da,Db,Dc,Dd,De,Df,Dg,Dh,Di,Dj,Dk,Dl,Dm,Dn,Do,Dp,Dq,Dr,Ds,Dt,Du,Dv,Dw,Dx,Dy,Dz

MNKWVITSLFAISTLSASVASALEVRYMATPQQSTWQMATNTPLECRLVHPIPNYGDAEFSSRAGKKINLDFELKMRRPMGDTRNVSLVSMPPVWRPGEGADRITNLQFFKQFDGYIGGQTAWSLLSELEKGRYPTFSYQDWQSRDQRIEVALSSVLFQQPYNEFSDCISKLLPYSFEDISFTILHYDQGTSVELNKASQKRLAQIAEYVRYNQDIDLVLVSTYTDSTDTNNNSQNLSEQRAEVLREYFKSIGLPEDRIQVQGYGKRRPIADNASPIGKDKNRRVVISLGRTQV

Entity 5 Entity 5 polymer

Description description	Sodium-type flagellar protein MotX
Molecular weight formula_weight	24278.6 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ea,Eb,Ec,Ed,Ee,Ef,Eg,Eh,Ei,Ej,Ek,El,Em,En,Eo,Ep,Eq,Er,Es,Et,Eu,Ev,Ew,Ex,Ey,Ez

MKLRTVAASLLLAWHSSYNPAYAADLGEPVPIYSEAELIKLIEENKHLERVKADNCQIVEDIVARATRISLPSYEFLYGDMLAWGVCVDQDVELGLYYMENAAHQGLPAALEQLGRYYSRGTLVQQDKERAIPYLREAAAMGNLNARIQLAELLLRDYGSPLDYEDAYRWLYNSVTADQRTHNRIALLRQGLERRMPENIIARAKRRETFW

Entity 6 Entity 6 polymer

Description description	Lipoprotein
Molecular weight formula_weight	16460.0 kDa
Source method src_method	nat
Copy count entity_count	52

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;Fa,Fb,Fc,Fd,Fe,Ff,Fg,Fh,Fi,Fj,Fk,Fl,Fm,Fn,Fo,Fp,Fq,Fr,Fs,Ft,Fu,Fv,Fw,Fx,Fy,Fz,Ga,Gb,Gc,Gd,Ge,Gf,Gg,Gh,Gi,Gj,Gk,Gl,Gm,Gn,Go,Gp,Gq,Gr,Gs,Gt,Gu,Gv,Gw,Gx,Gy,Gz ;

MMKSSLLLLVAALMMTGCQPLQSMRPDDWLTAVGYANISEQRGRDEAEKQVRAMRASKIDAYRELAEQVYGMRISGRAELQDQRLGTELTAGAVDGVIRGAEVVRSYKVGDSYVTELRLDIRKMDKMRDYGEVQQVPEKRQMTLF

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.57 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	25553

fit	/app/data/saxs_computation/ye/9yec/9yec.fit
pddf	/app/data/pr_computation/ye/9yec/9yec.pr.out
profile	/app/data/saxs_computation/ye/9yec/9yec.dat

LPHT-ring in Vibrio cholerae at disassembled, closed state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar L-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar P-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar protein FlgT

State in the Current Structure

Other States of the Same Protein in the Database

Sodium-type flagellar protein MotY

State in the Current Structure

Other States of the Same Protein in the Database

Sodium-type flagellar protein MotX

State in the Current Structure

Other States of the Same Protein in the Database

Lipoprotein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)