9yfg

Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar L-ring protein

Vibrio cholerae O1 biovar El Tor str. N16961

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 298	Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 Lipoprotein × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGH_VIBCH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–227； UniProt 32–258 Author chain Ab； PDBConstruct 1–227； UniProt 32–258 Author chain Ac； PDBConstruct 1–227； UniProt 32–258 Author chain Ad； PDBConstruct 1–227； UniProt 32–258 Author chain Ae； PDBConstruct 1–227； UniProt 32–258 Author chain Af； PDBConstruct 1–227； UniProt 32–258 Author chain Ag； PDBConstruct 1–227； UniProt 32–258 Author chain Ah； PDBConstruct 1–227； UniProt 32–258 Author chain Ai； PDBConstruct 1–227； UniProt 32–258 Author chain Aj； PDBConstruct 1–227； UniProt 32–258 Author chain Ak； PDBConstruct 1–227； UniProt 32–258 Author chain Al； PDBConstruct 1–227； UniProt 32–258 Author chain Am； PDBConstruct 1–227； UniProt 32–258 Author chain An； PDBConstruct 1–227； UniProt 32–258 Author chain Ao； PDBConstruct 1–227； UniProt 32–258 Author chain Ap； PDBConstruct 1–227； UniProt 32–258 Author chain Aq； PDBConstruct 1–227； UniProt 32–258 Author chain Ar； PDBConstruct 1–227； UniProt 32–258 Author chain As； PDBConstruct 1–227； UniProt 32–258 Author chain At； PDBConstruct 1–227； UniProt 32–258 Author chain Au； PDBConstruct 1–227； UniProt 32–258 Author chain Av； PDBConstruct 1–227； UniProt 32–258 Author chain Aw； PDBConstruct 1–227； UniProt 32–258 Author chain Ax； PDBConstruct 1–227； UniProt 32–258 Author chain Ay； PDBConstruct 1–227； UniProt 32–258 Author chain Az； PDBConstruct 1–227； UniProt 32–258

Flagellar P-ring protein

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ14

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 298	Flagellar L-ring protein × 26 （Q9KQ13） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 Lipoprotein × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGI_VIBCH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain Ba； PDBConstruct 1–343； UniProt 19–361 Author chain Bb； PDBConstruct 1–343； UniProt 19–361 Author chain Bc； PDBConstruct 1–343； UniProt 19–361 Author chain Bd； PDBConstruct 1–343； UniProt 19–361 Author chain Be； PDBConstruct 1–343； UniProt 19–361 Author chain Bf； PDBConstruct 1–343； UniProt 19–361 Author chain Bg； PDBConstruct 1–343； UniProt 19–361 Author chain Bh； PDBConstruct 1–343； UniProt 19–361 Author chain Bi； PDBConstruct 1–343； UniProt 19–361 Author chain Bj； PDBConstruct 1–343； UniProt 19–361 Author chain Bk； PDBConstruct 1–343； UniProt 19–361 Author chain Bl； PDBConstruct 1–343； UniProt 19–361 Author chain Bm； PDBConstruct 1–343； UniProt 19–361 Author chain Bn； PDBConstruct 1–343； UniProt 19–361 Author chain Bo； PDBConstruct 1–343； UniProt 19–361 Author chain Bp； PDBConstruct 1–343； UniProt 19–361 Author chain Bq； PDBConstruct 1–343； UniProt 19–361 Author chain Br； PDBConstruct 1–343； UniProt 19–361 Author chain Bs； PDBConstruct 1–343； UniProt 19–361 Author chain Bt； PDBConstruct 1–343； UniProt 19–361 Author chain Bu； PDBConstruct 1–343； UniProt 19–361 Author chain Bv； PDBConstruct 1–343； UniProt 19–361 Author chain Bw； PDBConstruct 1–343； UniProt 19–361 Author chain Bx； PDBConstruct 1–343； UniProt 19–361 Author chain By； PDBConstruct 1–343； UniProt 19–361 Author chain Bz； PDBConstruct 1–343； UniProt 19–361

Flagellar protein FlgT

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KPZ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 298	Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 Lipoprotein × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KPZ9_VIBCH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain Ca； PDBConstruct 1–352； UniProt 26–377 Author chain Cb； PDBConstruct 1–352； UniProt 26–377 Author chain Cc； PDBConstruct 1–352； UniProt 26–377 Author chain Cd； PDBConstruct 1–352； UniProt 26–377 Author chain Ce； PDBConstruct 1–352； UniProt 26–377 Author chain Cf； PDBConstruct 1–352； UniProt 26–377 Author chain Cg； PDBConstruct 1–352； UniProt 26–377 Author chain Ch； PDBConstruct 1–352； UniProt 26–377 Author chain Ci； PDBConstruct 1–352； UniProt 26–377 Author chain Cj； PDBConstruct 1–352； UniProt 26–377 Author chain Ck； PDBConstruct 1–352； UniProt 26–377 Author chain Cl； PDBConstruct 1–352； UniProt 26–377 Author chain Cm； PDBConstruct 1–352； UniProt 26–377 Author chain Cn； PDBConstruct 1–352； UniProt 26–377 Author chain Co； PDBConstruct 1–352； UniProt 26–377 Author chain Cp； PDBConstruct 1–352； UniProt 26–377 Author chain Cq； PDBConstruct 1–352； UniProt 26–377 Author chain Cr； PDBConstruct 1–352； UniProt 26–377 Author chain Cs； PDBConstruct 1–352； UniProt 26–377 Author chain Ct； PDBConstruct 1–352； UniProt 26–377 Author chain Cu； PDBConstruct 1–352； UniProt 26–377 Author chain Cv； PDBConstruct 1–352； UniProt 26–377 Author chain Cw； PDBConstruct 1–352； UniProt 26–377 Author chain Cx； PDBConstruct 1–352； UniProt 26–377 Author chain Cy； PDBConstruct 1–352； UniProt 26–377 Author chain Cz； PDBConstruct 1–352； UniProt 26–377

Sodium-type flagellar protein MotY

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KT95

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 298	Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 Lipoprotein × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KT95_VIBCH
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Da； PDBConstruct 1–271； UniProt 23–293 Author chain Db； PDBConstruct 1–271； UniProt 23–293 Author chain Dc； PDBConstruct 1–271； UniProt 23–293 Author chain Dd； PDBConstruct 1–271； UniProt 23–293 Author chain De； PDBConstruct 1–271； UniProt 23–293 Author chain Df； PDBConstruct 1–271； UniProt 23–293 Author chain Dg； PDBConstruct 1–271； UniProt 23–293 Author chain Dh； PDBConstruct 1–271； UniProt 23–293 Author chain Di； PDBConstruct 1–271； UniProt 23–293 Author chain Dj； PDBConstruct 1–271； UniProt 23–293 Author chain Dk； PDBConstruct 1–271； UniProt 23–293 Author chain Dl； PDBConstruct 1–271； UniProt 23–293 Author chain Dm； PDBConstruct 1–271； UniProt 23–293 Author chain Dn； PDBConstruct 1–271； UniProt 23–293 Author chain Do； PDBConstruct 1–271； UniProt 23–293 Author chain Dp； PDBConstruct 1–271； UniProt 23–293 Author chain Dq； PDBConstruct 1–271； UniProt 23–293 Author chain Dr； PDBConstruct 1–271； UniProt 23–293 Author chain Ds； PDBConstruct 1–271； UniProt 23–293 Author chain Dt； PDBConstruct 1–271； UniProt 23–293 Author chain Du； PDBConstruct 1–271； UniProt 23–293 Author chain Dv； PDBConstruct 1–271； UniProt 23–293 Author chain Dw； PDBConstruct 1–271； UniProt 23–293 Author chain Dx； PDBConstruct 1–271； UniProt 23–293 Author chain Dy； PDBConstruct 1–271； UniProt 23–293 Author chain Dz； PDBConstruct 1–271； UniProt 23–293

Sodium-type flagellar protein MotX

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KNX9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 298	Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） FlgP × 52 Lipoprotein × 58 （Q9KQ01） FlgO domain-containing protein × 58 （Q9KQ00）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KNX9_VIBCH
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain Ea； PDBConstruct 1–183； UniProt 29–211 Author chain Eb； PDBConstruct 1–183； UniProt 29–211 Author chain Ec； PDBConstruct 1–183； UniProt 29–211 Author chain Ed； PDBConstruct 1–183； UniProt 29–211 Author chain Ee； PDBConstruct 1–183； UniProt 29–211 Author chain Ef； PDBConstruct 1–183； UniProt 29–211 Author chain Eg； PDBConstruct 1–183； UniProt 29–211 Author chain Eh； PDBConstruct 1–183； UniProt 29–211 Author chain Ei； PDBConstruct 1–183； UniProt 29–211 Author chain Ej； PDBConstruct 1–183； UniProt 29–211 Author chain Ek； PDBConstruct 1–183； UniProt 29–211 Author chain El； PDBConstruct 1–183； UniProt 29–211 Author chain Em； PDBConstruct 1–183； UniProt 29–211 Author chain En； PDBConstruct 1–183； UniProt 29–211 Author chain Eo； PDBConstruct 1–183； UniProt 29–211 Author chain Ep； PDBConstruct 1–183； UniProt 29–211 Author chain Eq； PDBConstruct 1–183； UniProt 29–211 Author chain Er； PDBConstruct 1–183； UniProt 29–211 Author chain Es； PDBConstruct 1–183； UniProt 29–211 Author chain Et； PDBConstruct 1–183； UniProt 29–211 Author chain Eu； PDBConstruct 1–183； UniProt 29–211 Author chain Ev； PDBConstruct 1–183； UniProt 29–211 Author chain Ew； PDBConstruct 1–183； UniProt 29–211 Author chain Ex； PDBConstruct 1–183； UniProt 29–211 Author chain Ey； PDBConstruct 1–183； UniProt 29–211 Author chain Ez； PDBConstruct 1–183； UniProt 29–211

Lipoprotein

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ01

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 298	Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 FlgO domain-containing protein × 58 （Q9KQ00）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KQ01_VIBCH
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Ha； PDBConstruct 1–105； UniProt 26–130 Author chain Hc； PDBConstruct 1–105； UniProt 26–130 Author chain He； PDBConstruct 1–105； UniProt 26–130 Author chain Hg； PDBConstruct 1–105； UniProt 26–130 Author chain Hi； PDBConstruct 1–105； UniProt 26–130 Author chain Hk； PDBConstruct 1–105； UniProt 26–130 Author chain Hm； PDBConstruct 1–105； UniProt 26–130 Author chain Ho； PDBConstruct 1–105； UniProt 26–130 Author chain Hq； PDBConstruct 1–105； UniProt 26–130 Author chain Hs； PDBConstruct 1–105； UniProt 26–130 Author chain Hu； PDBConstruct 1–105； UniProt 26–130 Author chain Hw； PDBConstruct 1–105； UniProt 26–130 Author chain Hy； PDBConstruct 1–105； UniProt 26–130 Author chain Ia； PDBConstruct 1–105； UniProt 26–130 Author chain Ic； PDBConstruct 1–105； UniProt 26–130 Author chain Ie； PDBConstruct 1–105； UniProt 26–130 Author chain Ig； PDBConstruct 1–105； UniProt 26–130 Author chain Ii； PDBConstruct 1–105； UniProt 26–130 Author chain Ik； PDBConstruct 1–105； UniProt 26–130 Author chain Im； PDBConstruct 1–105； UniProt 26–130 Author chain Io； PDBConstruct 1–105； UniProt 26–130 Author chain Iq； PDBConstruct 1–105； UniProt 26–130 Author chain Is； PDBConstruct 1–105； UniProt 26–130 Author chain Iu； PDBConstruct 1–105； UniProt 26–130 Author chain Iw； PDBConstruct 1–105； UniProt 26–130 Author chain Iy； PDBConstruct 1–105； UniProt 26–130 Author chain Ja； PDBConstruct 1–105； UniProt 26–130 Author chain Jc； PDBConstruct 1–105； UniProt 26–130 Author chain Je； PDBConstruct 1–105； UniProt 26–130 Author chain Jg； PDBConstruct 1–105； UniProt 26–130 Author chain Ji； PDBConstruct 1–105； UniProt 26–130 Author chain Jk； PDBConstruct 1–105； UniProt 26–130 Author chain Jm； PDBConstruct 1–105； UniProt 26–130 Author chain Jo； PDBConstruct 1–105； UniProt 26–130 Author chain Jq； PDBConstruct 1–105； UniProt 26–130 Author chain Js； PDBConstruct 1–105； UniProt 26–130 Author chain Ju； PDBConstruct 1–105； UniProt 26–130 Author chain Jw； PDBConstruct 1–105； UniProt 26–130 Author chain Jy； PDBConstruct 1–105； UniProt 26–130 Author chain Ka； PDBConstruct 1–105； UniProt 26–130 Author chain Kc； PDBConstruct 1–105； UniProt 26–130 Author chain Ke； PDBConstruct 1–105； UniProt 26–130 Author chain Kg； PDBConstruct 1–105； UniProt 26–130 Author chain Ki； PDBConstruct 1–105； UniProt 26–130 Author chain Kk； PDBConstruct 1–105； UniProt 26–130 Author chain Km； PDBConstruct 1–105； UniProt 26–130 Author chain Ko； PDBConstruct 1–105； UniProt 26–130 Author chain Kq； PDBConstruct 1–105； UniProt 26–130 Author chain Ks； PDBConstruct 1–105； UniProt 26–130 Author chain Ku； PDBConstruct 1–105； UniProt 26–130 Author chain Kw； PDBConstruct 1–105； UniProt 26–130 Author chain Ky； PDBConstruct 1–105； UniProt 26–130 Author chain La； PDBConstruct 1–105； UniProt 26–130 Author chain Lc； PDBConstruct 1–105； UniProt 26–130 Author chain Le； PDBConstruct 1–105； UniProt 26–130 Author chain Lg； PDBConstruct 1–105； UniProt 26–130 Author chain Li； PDBConstruct 1–105； UniProt 26–130 Author chain Lk； PDBConstruct 1–105； UniProt 26–130

FlgO domain-containing protein

Vibrio cholerae O1 biovar El Tor str. N16961

UniProt Q9KQ00

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 298	Flagellar L-ring protein × 26 （Q9KQ13） Flagellar P-ring protein × 26 （Q9KQ14） Flagellar protein FlgT × 26 （Q9KPZ9） Sodium-type flagellar protein MotY × 26 （Q9KT95） Sodium-type flagellar protein MotX × 26 （Q9KNX9） FlgP × 52 Lipoprotein × 58 （Q9KQ01）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KQ00_VIBCH
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Hb； PDBConstruct 1–190； UniProt 32–221 Author chain Hd； PDBConstruct 1–190； UniProt 32–221 Author chain Hf； PDBConstruct 1–190； UniProt 32–221 Author chain Hh； PDBConstruct 1–190； UniProt 32–221 Author chain Hj； PDBConstruct 1–190； UniProt 32–221 Author chain Hl； PDBConstruct 1–190； UniProt 32–221 Author chain Hn； PDBConstruct 1–190； UniProt 32–221 Author chain Hp； PDBConstruct 1–190； UniProt 32–221 Author chain Hr； PDBConstruct 1–190； UniProt 32–221 Author chain Ht； PDBConstruct 1–190； UniProt 32–221 Author chain Hv； PDBConstruct 1–190； UniProt 32–221 Author chain Hx； PDBConstruct 1–190； UniProt 32–221 Author chain Hz； PDBConstruct 1–190； UniProt 32–221 Author chain Ib； PDBConstruct 1–190； UniProt 32–221 Author chain Id； PDBConstruct 1–190； UniProt 32–221 Author chain If； PDBConstruct 1–190； UniProt 32–221 Author chain Ih； PDBConstruct 1–190； UniProt 32–221 Author chain Ij； PDBConstruct 1–190； UniProt 32–221 Author chain Il； PDBConstruct 1–190； UniProt 32–221 Author chain In； PDBConstruct 1–190； UniProt 32–221 Author chain Ip； PDBConstruct 1–190； UniProt 32–221 Author chain Ir； PDBConstruct 1–190； UniProt 32–221 Author chain It； PDBConstruct 1–190； UniProt 32–221 Author chain Iv； PDBConstruct 1–190； UniProt 32–221 Author chain Ix； PDBConstruct 1–190； UniProt 32–221 Author chain Iz； PDBConstruct 1–190； UniProt 32–221 Author chain Jb； PDBConstruct 1–190； UniProt 32–221 Author chain Jd； PDBConstruct 1–190； UniProt 32–221 Author chain Jf； PDBConstruct 1–190； UniProt 32–221 Author chain Jh； PDBConstruct 1–190； UniProt 32–221 Author chain Jj； PDBConstruct 1–190； UniProt 32–221 Author chain Jl； PDBConstruct 1–190； UniProt 32–221 Author chain Jn； PDBConstruct 1–190； UniProt 32–221 Author chain Jp； PDBConstruct 1–190； UniProt 32–221 Author chain Jr； PDBConstruct 1–190； UniProt 32–221 Author chain Jt； PDBConstruct 1–190； UniProt 32–221 Author chain Jv； PDBConstruct 1–190； UniProt 32–221 Author chain Jx； PDBConstruct 1–190； UniProt 32–221 Author chain Jz； PDBConstruct 1–190； UniProt 32–221 Author chain Kb； PDBConstruct 1–190； UniProt 32–221 Author chain Kd； PDBConstruct 1–190； UniProt 32–221 Author chain Kf； PDBConstruct 1–190； UniProt 32–221 Author chain Kh； PDBConstruct 1–190； UniProt 32–221 Author chain Kj； PDBConstruct 1–190； UniProt 32–221 Author chain Kl； PDBConstruct 1–190； UniProt 32–221 Author chain Kn； PDBConstruct 1–190； UniProt 32–221 Author chain Kp； PDBConstruct 1–190； UniProt 32–221 Author chain Kr； PDBConstruct 1–190； UniProt 32–221 Author chain Kt； PDBConstruct 1–190； UniProt 32–221 Author chain Kv； PDBConstruct 1–190； UniProt 32–221 Author chain Kx； PDBConstruct 1–190； UniProt 32–221 Author chain Kz； PDBConstruct 1–190； UniProt 32–221 Author chain Lb； PDBConstruct 1–190； UniProt 32–221 Author chain Ld； PDBConstruct 1–190； UniProt 32–221 Author chain Lf； PDBConstruct 1–190； UniProt 32–221 Author chain Lh； PDBConstruct 1–190； UniProt 32–221 Author chain Lj； PDBConstruct 1–190； UniProt 32–221 Author chain Ll； PDBConstruct 1–190； UniProt 32–221

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9yfg
Deposition date deposition_date	2025-09-25
Structure title title	Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state
Keywords keywords	Vibrio cholerae, in situ cryo-EM, closed, flagellar outer membrane complex, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9yfg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9yfg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9yfg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	152.40 Å
Total Rg	152.30 Å
Atom count	412635
Residues	52997
Excluded volume	7299400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9yfg__assembly_1__model_1`	298-meric （298）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Flagellar L-ring protein
Molecular weight formula_weight	24256.5 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa,Ab,Ac,Ad,Ae,Af,Ag,Ah,Ai,Aj,Ak,Al,Am,An,Ao,Ap,Aq,Ar,As,At,Au,Av,Aw,Ax,Ay,Az
Atom count atom_count	412635

TTTVDAVEGDKSESNSGLTDALRNRTDPVAGDPAWAPIHPKGKPEHYAAETGSLFNLASSSSMYDDSKPRGVGDIITVTLNESTKAAKSADADLNKKNDASMDPLAVGGKDLTIGDYNFSYALKNDNKFSGSAAANQSNSMSGSITVEVIEVLANGNLVIRGEKWLTLNTGDEYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEPGFLARFFNVSL

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 2 Entity 2 polymer

Description description	Flagellar P-ring protein
Molecular weight formula_weight	35702.6 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ba,Bb,Bc,Bd,Be,Bf,Bg,Bh,Bi,Bj,Bk,Bl,Bm,Bn,Bo,Bp,Bq,Br,Bs,Bt,Bu,Bv,Bw,Bx,By,Bz

ARIKDVAQVAGVRNNQLVGYGLVTGLPGTGESTPFTDQSFNAMLQSFGIQLPPGTKPKTKNVAAVIVTADLPAFSKQGQTIDITVSSIGSAKSLRGGTLMQTFLKGLDGQVYAVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGDYITFNLFESDFTTAQRLADAVNQFLGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENLEFNPADSAAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNALGGGQTVVVPNTEIEVTEKQGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLIII

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 3 Entity 3 polymer

Description description	Flagellar protein FlgT
Molecular weight formula_weight	39808.2 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ca,Cb,Cc,Cd,Ce,Cf,Cg,Ch,Ci,Cj,Ck,Cl,Cm,Cn,Co,Cp,Cq,Cr,Cs,Ct,Cu,Cv,Cw,Cx,Cy,Cz

YEVTGSAAIVSSEEVARLHALEDALYKAVNFAGADIGSISNLMPLLESDRREYLFANHEVRYILIEERKAINNVMYVRTRIDIYPSATACHVEQYKKTMLIGNIDLASPQQAVMGQIYQVGDDFAQVINRRLEQESRSFVSVGTTQYDIDPKAPERIKMIAQDAGAQYIMGGMITDLTATIEQKTLQDDIINRQFAMEISVFDGKTGNEVMTRTYREVARWPFPKTSQIDTRSARFWASTYGEMMLRVSRNIMLDLESEISCKITLPQIVAKFGTTATMDLGRIHGVKQGDKLSLWHTGAFIDQQGLPRNKVTQSEITLTVSRVYEHEAELTVDQPELAYSIQIGDVMHKQM

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 4 Entity 4 polymer

Description description	Sodium-type flagellar protein MotY
Molecular weight formula_weight	31208.0 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Da,Db,Dc,Dd,De,Df,Dg,Dh,Di,Dj,Dk,Dl,Dm,Dn,Do,Dp,Dq,Dr,Ds,Dt,Du,Dv,Dw,Dx,Dy,Dz

LEVRYMATPQQSTWQMATNTPLECRLVHPIPNYGDAEFSSRAGKKINLDFELKMRRPMGDTRNVSLVSMPPVWRPGEGADRITNLQFFKQFDGYIGGQTAWSLLSELEKGRYPTFSYQDWQSRDQRIEVALSSVLFQQPYNEFSDCISKLLPYSFEDISFTILHYDQGTSVELNKASQKRLAQIAEYVRYNQDIDLVLVSTYTDSTDTNNNSQNLSEQRAEVLREYFKSIGLPEDRIQVQGYGKRRPIADNASPIGKDKNRRVVISLGRTQ

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 5 Entity 5 polymer

Description description	Sodium-type flagellar protein MotX
Molecular weight formula_weight	21244.1 kDa
Source method src_method	man
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ea,Eb,Ec,Ed,Ee,Ef,Eg,Eh,Ei,Ej,Ek,El,Em,En,Eo,Ep,Eq,Er,Es,Et,Eu,Ev,Ew,Ex,Ey,Ez

PVPIYSEAELIKLIEENKHLERVKADNCQIVEDIVARATRISLPSYEFLYGDMLAWGVCVDQDVELGLYYMENAAHQGLPAALEQLGRYYSRGTLVQQDKERAIPYLREAAAMGNLNARIQLAELLLRDYGSPLDYEDAYRWLYNSVTADQRTHNRIALLRQGLERRMPENIIARAKRRETFW

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 6 Entity 6 polymer

Description description	FlgP
Molecular weight formula_weight	1506.8 kDa
Source method src_method	man
Copy count entity_count	52

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;Fa,Fb,Fc,Fd,Fe,Ff,Fg,Fh,Fi,Fj,Fk,Fl,Fm,Fn,Fo,Fp,Fq,Fr,Fs,Ft,Fu,Fv,Fw,Fx,Fy,Fz,Ga,Gb,Gc,Gd,Ge,Gf,Gg,Gh,Gi,Gj,Gk,Gl,Gm,Gn,Go,Gp,Gq,Gr,Gs,Gt,Gu,Gv,Gw,Gx,Gy,Gz ;

QQVPEKRQMTLF

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 7 Entity 7 polymer

Description description	Lipoprotein
Molecular weight formula_weight	11947.4 kDa
Source method src_method	man
Copy count entity_count	58

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;Ha,Hc,He,Hg,Hi,Hk,Hm,Ho,Hq,Hs,Hu,Hw,Hy,Ia,Ic,Ie,Ig,Ii,Ik,Im,Io,Iq,Is,Iu,Iw,Iy,Ja,Jc,Je,Jg,Ji,Jk,Jm,Jo,Jq,Js,Ju,Jw,Jy,Ka,Kc,Ke,Kg,Ki,Kk,Km,Ko,Kq,Ks,Ku,Kw,Ky,La,Lc,Le,Lg,Li,Lk ;

PDDWLTAVGYANISEQRGRDEAEKQVRAMRASKIDAYRELAEQVYGMRISGRAELQDQRLGTELTAGAVDGVIRGAEVVRSYKVGDSYVTELRLDIRKMDKMRDY

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

Entity 8 Entity 8 polymer

Description description	FlgO domain-containing protein
Molecular weight formula_weight	21395.1 kDa
Source method src_method	man
Copy count entity_count	58

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;Hb,Hd,Hf,Hh,Hj,Hl,Hn,Hp,Hr,Ht,Hv,Hx,Hz,Ib,Id,If,Ih,Ij,Il,In,Ip,Ir,It,Iv,Ix,Iz,Jb,Jd,Jf,Jh,Jj,Jl,Jn,Jp,Jr,Jt,Jv,Jx,Jz,Kb,Kd,Kf,Kh,Kj,Kl,Kn,Kp,Kr,Kt,Kv,Kx,Kz,Lb,Ld,Lf,Lh,Lj,Ll ;

IYNGKEPYNGSQFMLMESPRHTLDFFVESMTEDLMLSNTSITARTPIAVTSFVDLQNMDTTNWLGNSVSEGFIHQFQRRGFKVVDFKTTGSIQVTQQGDFAFSRDWKNLSSEQEVQYVLTGTMLRQEGGVIVNARVVGMHSRIVVATAQGFLPADRIGRDLDTLNSIRTQDGVLIRSDPTITQPYTVILR

Source Source

Source organism organism	Vibrio cholerae O1 biovar El Tor str. N16961
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Vibrio cholerae O1 biovar El Tor str. N16961

▶

Resolution resolution	3.55 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	177296

Flagellar outer membrane complex in Vibrio cholerae at disassembled, closed state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar L-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar P-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar protein FlgT

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sodium-type flagellar protein MotY

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sodium-type flagellar protein MotX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Lipoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

FlgO domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9yfg__assembly_1__model_1

9yfg__assembly_1__model_1 | I(q)

9yfg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer